PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Niben101Scf00337g02001.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Solanales; Solanaceae; Nicotianoideae; Nicotianeae; Nicotiana
|
||||||||
Family | Dof | ||||||||
Protein Properties | Length: 139aa MW: 15797.3 Da PI: 10.3166 | ||||||||
Description | Dof family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | zf-Dof | 115.4 | 2.4e-36 | 66 | 126 | 2 | 62 |
zf-Dof 2 kekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkkss 62 + +a+kcprCds ntkfCyynny+l qPr+fC++ rryWtkGG lrnvPvGgg+rknk+s+ Niben101Scf00337g02001.1 66 QPQAVKCPRCDSLNTKFCYYNNYNLCQPRHFCQSRRRYWTKGGILRNVPVGGGCRKNKRSK 126 56899*****************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
ProDom | PD007478 | 1.0E-24 | 64 | 124 | IPR003851 | Zinc finger, Dof-type |
Pfam | PF02701 | 3.5E-30 | 68 | 124 | IPR003851 | Zinc finger, Dof-type |
PROSITE profile | PS50884 | 27.41 | 70 | 124 | IPR003851 | Zinc finger, Dof-type |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 139 aa Download sequence Send to blast |
MEEAAIPSQI PKSANIEPCL KIHRKNCTSN FLRSILSKIC KIYIQLEVAE GGFTAVGGDR 60 RLRLNQPQAV KCPRCDSLNT KFCYYNNYNL CQPRHFCQSR RRYWTKGGIL RNVPVGGGCR 120 KNKRSKPKRS AVSTNDDTC |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 122 | 128 | KRSKPKR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds specifically to a 5'-AA[AG]G-3' consensus core sequence. Enhances the DNA binding of OBF transcription factors to OCS elements (By similarity). {ECO:0000250}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_019224676.1 | 1e-48 | PREDICTED: dof zinc finger protein DOF5.4-like | ||||
Swissprot | Q8LDR0 | 7e-35 | DOF54_ARATH; Dof zinc finger protein DOF5.4 | ||||
TrEMBL | A0A314KV90 | 2e-47 | A0A314KV90_NICAT; Dof zinc finger protein dof5.4 | ||||
STRING | XP_009786397.1 | 5e-44 | (Nicotiana sylvestris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA88 | 24 | 419 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G60850.1 | 3e-37 | OBF binding protein 4 |
Publications ? help Back to Top | |||
---|---|---|---|
|