PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_9030_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 208aa MW: 24003 Da PI: 4.5686 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 109.2 | 4.7e-34 | 10 | 129 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgk.dkevlsk 95 lppGfrF Ptdeelv ++L +k++ +++ ++i+++d++ + Pw+L+ k+ + ++wyfFs+ + r t++gyWk+ + +++++++ Neem_9030_f_1 10 LPPGFRFLPTDEELVLHFLYRKASLLPCNP-NIIPDLDLNFHAPWQLNGKALCSGNKWYFFSQISG--------DRETENGYWKQMENiEEPIFTT 96 79*************************999.89**************976667899******9754........68899*****87765999**** PP NAM 96 kgelvglkktLvfykgrapkgektdWvmheyrl 128 g+++g+kk Lvfy g+ap g++t+W+m+ey+l Neem_9030_f_1 97 AGKKIGVKKYLVFYIGEAPVGVETNWIMQEYHL 129 *******************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.12E-41 | 7 | 160 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 39.366 | 10 | 161 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-22 | 11 | 129 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0043067 | Biological Process | regulation of programmed cell death | ||||
GO:0048367 | Biological Process | shoot system development | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 208 aa Download sequence Send to blast |
MCDINATINL PPGFRFLPTD EELVLHFLYR KASLLPCNPN IIPDLDLNFH APWQLNGKAL 60 CSGNKWYFFS QISGDRETEN GYWKQMENIE EPIFTTAGKK IGVKKYLVFY IGEAPVGVET 120 NWIMQEYHLC NYGFSAKSHK RKGNRKVLES CKWVLCRVYE REGYSQSFCN YGNHVEDDDD 180 EDNGTELSCL DEMYLSLDDD LADISLPN |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 9e-36 | 2 | 166 | 9 | 170 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 9e-36 | 2 | 166 | 9 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 9e-36 | 2 | 166 | 9 | 170 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 9e-36 | 2 | 166 | 9 | 170 | NO APICAL MERISTEM PROTEIN |
3swm_A | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swm_B | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swm_C | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swm_D | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swp_A | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swp_B | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swp_C | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
3swp_D | 1e-35 | 2 | 166 | 12 | 173 | NAC domain-containing protein 19 |
4dul_A | 9e-36 | 2 | 166 | 9 | 170 | NAC domain-containing protein 19 |
4dul_B | 9e-36 | 2 | 166 | 9 | 170 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor that influences tracheary elements and xylem development by negatively regulating secondary cell wall fiber synthesis and programmed cell death. {ECO:0000269|PubMed:18069942, ECO:0000269|PubMed:20458494}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_006465058.1 | 6e-98 | NAC domain-containing protein 104-like isoform X3 | ||||
Swissprot | Q8GWK6 | 1e-61 | NC104_ARATH; NAC domain-containing protein 104 | ||||
TrEMBL | V4SCU4 | 1e-96 | V4SCU4_9ROSI; Uncharacterized protein | ||||
STRING | XP_006432173.1 | 2e-97 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM3674 | 28 | 62 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G64530.1 | 5e-59 | xylem NAC domain 1 |
Publications ? help Back to Top | |||
---|---|---|---|
|