PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_7585_f_4 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 154aa MW: 18158.5 Da PI: 7.496 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 143 | 1.7e-44 | 6 | 139 | 2 | 128 |
NAM 2 ppGfrFhPtdeelvveyLkkkvegkk....leleevikevdiykvePwdLpk....kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkd 89 ppGfrF Pt+eelv++yL++k+eg++ ++++i+ v+iy+++PwdLp+ ++ + ++w+fF++r++++a+g r+nr t++gyWkatg+ Neem_7585_f_4 6 PPGFRFYPTEEELVSFYLRNKLEGRRedlnRLMDRIIPVVNIYDYNPWDLPQfseyLCHRDPEQWFFFIPRHENEARGGRPNRLTTAGYWKATGSP 101 9*************************66532233479*************9646653344667********************************* PP NAM 90 kevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 v+s ++++vg k+t+vfy+grap+g+kt+W m+ey++ Neem_7585_f_4 102 GFVYS-SNRVVGEKRTMVFYRGRAPNGTKTEWKMNEYKV 139 *****.9999***************************86 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.57E-47 | 3 | 144 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 45.955 | 5 | 154 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.6E-23 | 6 | 139 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 154 aa Download sequence Send to blast |
MVEEYPPGFR FYPTEEELVS FYLRNKLEGR REDLNRLMDR IIPVVNIYDY NPWDLPQFSE 60 YLCHRDPEQW FFFIPRHENE ARGGRPNRLT TAGYWKATGS PGFVYSSNRV VGEKRTMVFY 120 RGRAPNGTKT EWKMNEYKVI EGEASTTTGA PPMV |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 1e-33 | 6 | 141 | 18 | 144 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 1e-33 | 6 | 141 | 18 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 1e-33 | 6 | 141 | 18 | 144 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 1e-33 | 6 | 141 | 18 | 144 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swm_B | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swm_C | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swm_D | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swp_A | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swp_B | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swp_C | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
3swp_D | 2e-33 | 6 | 141 | 21 | 147 | NAC domain-containing protein 19 |
4dul_A | 1e-33 | 6 | 141 | 18 | 144 | NAC domain-containing protein 19 |
4dul_B | 1e-33 | 6 | 141 | 18 | 144 | NAC domain-containing protein 19 |
Search in ModeBase |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007027830.2 | 2e-88 | PREDICTED: NAC domain-containing protein 90 | ||||
Swissprot | Q9FMR3 | 2e-57 | NAC90_ARATH; NAC domain-containing protein 90 | ||||
TrEMBL | A0A061EV89 | 1e-87 | A0A061EV89_THECC; NAC domain containing protein 90 | ||||
STRING | EOY08332 | 2e-88 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM10159 | 10 | 34 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G22380.1 | 6e-60 | NAC domain containing protein 90 |
Publications ? help Back to Top | |||
---|---|---|---|
|