| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | Homeobox | 65.3 | 8.2e-21 | 33 | 94 | 1 | 57 |
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
++ R+++t+eq+++L +lF++ r+ps++++++++++l +++ ++V++WFqN++a+e++
Neem_42804_f_1 33 KCGRWNPTTEQVKVLTDLFRSgLRTPSTDQIQKISTQLsfygKIESKNVFYWFQNHKARERQ 94
568*****************99**************************************97 PP
|
| 2 | Wus_type_Homeobox | 114.7 | 4.7e-37 | 33 | 96 | 2 | 65 |
Wus_type_Homeobox 2 artRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
++ RW+Pt+eQ+k+L++l++sGlrtP++++iq+i+++L+ yGkie+kNVfyWFQN+kaRerqk+
Neem_42804_f_1 33 KCGRWNPTTEQVKVLTDLFRSGLRTPSTDQIQKISTQLSFYGKIESKNVFYWFQNHKARERQKR 96
678***********************************************************95 PP
|
| Publications
? help Back to Top |
- Conte MG,Gaillard S,Droc G,Perin C
Phylogenomics of plant genomes: a methodology for genome-wide searches for orthologs in plants. BMC Genomics, 2008. 9: p. 183 [PMID:18426584] - Chu H, et al.
A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] - Tian H,Niu T,Yu Q,Quan T,Ding Z
Auxin gradient is crucial for the maintenance of root distal stem cell identity in Arabidopsis. Plant Signal Behav, 2013. 8(12): p. e26429 [PMID:24056047] - Tian H,Jia Y,Niu T,Yu Q,Ding Z
The key players of the primary root growth and development also function in lateral roots in Arabidopsis. Plant Cell Rep., 2014. 33(5): p. 745-53 [PMID:24504658] - Reyes-Hernández BJ, et al.
The root indeterminacy-to-determinacy developmental switch is operated through a folate-dependent pathway in Arabidopsis thaliana. New Phytol., 2014. 202(4): p. 1223-36 [PMID:24635769] - Bennett T,van den Toorn A,Willemsen V,Scheres B
Precise control of plant stem cell activity through parallel regulatory inputs. Development, 2014. 141(21): p. 4055-64 [PMID:25256342] - Ji H, et al.
PRL1 modulates root stem cell niche activity and meristem size through WOX5 and PLTs in Arabidopsis. Plant J., 2015. 81(3): p. 399-412 [PMID:25438658] - Su YH,Liu YB,Bai B,Zhang XS
Establishment of embryonic shoot-root axis is involved in auxin and cytokinin response during Arabidopsis somatic embryogenesis. Front Plant Sci, 2014. 5: p. 792 [PMID:25642237] - Jia Y, et al.
The Arabidopsis thaliana elongator complex subunit 2 epigenetically affects root development. J. Exp. Bot., 2015. 66(15): p. 4631-42 [PMID:25998905] - Zhang M, et al.
A tetratricopeptide repeat domain-containing protein SSR1 located in mitochondria is involved in root development and auxin polar transport in Arabidopsis. Plant J., 2015. 83(4): p. 582-99 [PMID:26072661] - Kong X,Lu S,Tian H,Ding Z
WOX5 is Shining in the Root Stem Cell Niche. Trends Plant Sci., 2015. 20(10): p. 601-603 [PMID:26440429] - Hu X,Xu L
Transcription Factors WOX11/12 Directly Activate WOX5/7 to Promote Root Primordia Initiation and Organogenesis. Plant Physiol., 2016. 172(4): p. 2363-2373 [PMID:27784768] - Zhang Y,Jiao Y,Jiao H,Zhao H,Zhu YX
Two-Step Functional Innovation of the Stem-Cell Factors WUS/WOX5 during Plant Evolution. Mol. Biol. Evol., 2017. 34(3): p. 640-653 [PMID:28053005] - Singh S, et al.
Sirtinol, a Sir2 protein inhibitor, affects stem cell maintenance and root development in Arabidopsis thaliana by modulating auxin-cytokinin signaling components. Sci Rep, 2017. 7: p. 42450 [PMID:28195159] - García-Gómez ML,Azpeitia E,Álvarez-Buylla ER
A dynamic genetic-hormonal regulatory network model explains multiple cellular behaviors of the root apical meristem of Arabidopsis thaliana. PLoS Comput. Biol., 2017. 13(4): p. e1005488 [PMID:28426669] - Long Y, et al.
In vivo FRET-FLIM reveals cell-type-specific protein interactions in Arabidopsis roots. Nature, 2017. 548(7665): p. 97-102 [PMID:28746306] - Bruno L, et al.
In Arabidopsis thaliana Cadmium Impact on the Growth of Primary Root by Altering SCR Expression and Auxin-Cytokinin Cross-Talk. Front Plant Sci, 2017. 8: p. 1323 [PMID:28798767] - Hu B, et al.
Divergent regeneration-competent cells adopt a common mechanism for callus initiation in angiosperms. Regeneration (Oxf), 2017. 4(3): p. 132-139 [PMID:28975033] - Lozano-Elena F,Planas-Riverola A,Vilarrasa-Blasi J,Schwab R,Caño-Delgado AI
Paracrine brassinosteroid signaling at the stem cell niche controls cellular regeneration. J. Cell. Sci., 2019. [PMID:29242230] - Xu C, et al.
Control of auxin-induced callus formation by bZIP59-LBD complex in Arabidopsis regeneration. Nat Plants, 2018. 4(2): p. 108-115 [PMID:29358751] - Dolzblasz A, et al.
Impairment of Meristem Proliferation in Plants Lacking the Mitochondrial Protease AtFTSH4. Int J Mol Sci, 2018. [PMID:29538317]
|