PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_40966_f_1

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

M-type_MADS

Protein Properties

Length: 84aa MW: 9751.25 Da PI: 9.5851

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_40966_f_1	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	98.3	3.1e-31	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 +rienk nrqvtfskRrng+lKKA+ELS LCdaevaviifss+gkl+e++s Neem_40966_f_1 9 ERIENKVNRQVTFSKRRNGLLKKAYELSLLCDAEVAVIIFSSHGKLFEFAS 59 69***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.0E-39	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	31.847	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	9.23E-38	2	67	No hit	No description
SuperFamily	SSF55455	1.18E-30	2	71	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	4.8E-28	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.2E-31	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 84 aa Download sequence Send to blast
MGRGKVVLER IENKVNRQVT FSKRRNGLLK KAYELSLLCD AEVAVIIFSS HGKLFEFASN 60 DVSELVYYIK SQREWEIGER TEKV

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6byy_A	7e-23	1	66	1	66	MEF2 CHIMERA
6byy_B	7e-23	1	66	1	66	MEF2 CHIMERA
6byy_C	7e-23	1	66	1	66	MEF2 CHIMERA
6byy_D	7e-23	1	66	1	66	MEF2 CHIMERA
6bz1_A	6e-23	1	66	1	66	MEF2 CHIMERA
6bz1_B	6e-23	1	66	1	66	MEF2 CHIMERA
6bz1_C	6e-23	1	66	1	66	MEF2 CHIMERA
6bz1_D	6e-23	1	66	1	66	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor. Regulates floral organ identity and floral meristem determinacy. May be involved in the control of flowering time. {ECO:0000269\|PubMed:19820190, ECO:0000269\|Ref.8}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_011030020.1	8e-34	PREDICTED: truncated transcription factor CAULIFLOWER A-like
Refseq	XP_011030021.1	8e-34	PREDICTED: truncated transcription factor CAULIFLOWER A-like
Refseq	XP_023923299.1	1e-33	MADS-box transcription factor 17-like
Swissprot	Q6EU39	1e-29	MADS6_ORYSJ; MADS-box transcription factor 6
TrEMBL	A0A2N9FVP9	5e-32	A0A2N9FVP9_FAGSY; Uncharacterized protein
TrEMBL	U5FXL4	7e-32	U5FXL4_POPTR; Uncharacterized protein
STRING	POPTR_0015s14010.1	7e-31	(Populus trichocarpa)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G03710.3	3e-31	MIKC_MADS family protein

Publications ? help Back to Top
Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Zhang J,Nallamilli BR,Mujahid H,Peng Z OsMADS6 plays an essential role in endosperm nutrient accumulation and is subject to epigenetic regulation in rice (Oryza sativa). Plant J., 2010. 64(4): p. 604-17 [PMID:20822505] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yadav SR,Khanday I,Majhi BB,Veluthambi K,Vijayraghavan U Auxin-responsive OsMGH3, a common downstream target of OsMADS1 and OsMADS6, controls rice floret fertility. Plant Cell Physiol., 2011. 52(12): p. 2123-35 [PMID:22016342] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Conrad LJ, et al. The polycomb group gene EMF2B is essential for maintenance of floral meristem determinacy in rice. Plant J., 2014. 80(5): p. 883-94 [PMID:25279942] Zhang J, et al. Down-regulation of a LBD-like gene, OsIG1, leads to occurrence of unusual double ovules and developmental abnormalities of various floral organs and megagametophyte in rice. J. Exp. Bot., 2015. 66(1): p. 99-112 [PMID:25324400] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Zhang B, et al. A High Temperature-Dependent Mitochondrial Lipase EXTRA GLUME1 Promotes Floral Phenotypic Robustness against Temperature Fluctuation in Rice (Oryza sativa L.). PLoS Genet., 2016. 12(7): p. e1006152 [PMID:27367609]