![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_39334_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | SBP | ||||||||
Protein Properties | Length: 116aa MW: 13262.9 Da PI: 10.4085 | ||||||||
Description | SBP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SBP | 134.1 | 4.5e-42 | 24 | 100 | 2 | 78 |
-SSTT-----TT--HHHHHTT--HHHHT-S-EEETTEEEEE-TTTSSEEETTT--SS--S-STTTT-------S--- CS SBP 2 CqvegCeadlseakeyhrrhkvCevhskapvvlvsgleqrfCqqCsrfhelsefDeekrsCrrrLakhnerrrkkqa 78 C v+gC adl+++++yhrrhkvCe hsk+p+v+++g+eqrfCqqCsrfh+l efDe+krsCr+rL++hn+rrrk+q+ Neem_39334_f_1 24 CLVDGCVADLAKCRDYHRRHKVCELHSKTPKVTIQGHEQRFCQQCSRFHSLVEFDEGKRSCRKRLDGHNRRRRKPQP 100 **************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:4.10.1100.10 | 9.1E-35 | 16 | 85 | IPR004333 | Transcription factor, SBP-box |
PROSITE profile | PS51141 | 31.864 | 21 | 98 | IPR004333 | Transcription factor, SBP-box |
SuperFamily | SSF103612 | 2.88E-39 | 22 | 103 | IPR004333 | Transcription factor, SBP-box |
Pfam | PF03110 | 7.9E-31 | 24 | 97 | IPR004333 | Transcription factor, SBP-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 116 aa Download sequence Send to blast |
MESSASSSSK RARAPSNGNQ VPSCLVDGCV ADLAKCRDYH RRHKVCELHS KTPKVTIQGH 60 EQRFCQQCSR FHSLVEFDEG KRSCRKRLDG HNRRRRKPQP DSLSINSGRF FPEHQG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ul4_A | 1e-29 | 14 | 97 | 1 | 84 | squamosa promoter binding protein-like 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 80 | 97 | KRSCRKRLDGHNRRRRKP |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. | |||||
UniProt | Trans-acting factor that binds specifically to the consensus nucleotide sequence 5'-TNCGTACAA-3'. {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Negatively regulated by microRNAs miR156 and miR157. {ECO:0000305|PubMed:12202040}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_017970620.1 | 8e-71 | PREDICTED: squamosa promoter-binding-like protein 16 | ||||
Refseq | XP_017970621.1 | 8e-71 | PREDICTED: squamosa promoter-binding-like protein 16 | ||||
Swissprot | B9DI20 | 4e-46 | SP13A_ARATH; Squamosa promoter-binding-like protein 13A | ||||
Swissprot | P0DI11 | 4e-46 | SP13B_ARATH; Squamosa promoter-binding-like protein 13B | ||||
TrEMBL | A0A061E606 | 7e-69 | A0A061E606_THECC; Squamosa promoter-binding protein transcription factor family protein, putative isoform 1 | ||||
STRING | EOX99771 | 1e-69 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM4111 | 27 | 59 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G50670.1 | 2e-47 | SBP family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|