 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
Neem_29716_f_1 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
| Family |
bZIP |
| Protein Properties |
Length: 86aa MW: 9800.15 Da PI: 9.1212 |
| Description |
bZIP family protein |
| Gene Model |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | bZIP_1 | 43.8 | 5.5e-14 | 1 | 39 | 10 | 48 |
HHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
bZIP_1 10 kqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkke 48
++kNRe+A rsR+RK+a++ eLe +v++L++ N++L+k+
Neem_29716_f_1 1 MIKNRESAARSRARKQAYTLELEAEVAKLKELNQELQKK 39
68********************************99975 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Binds to the ABA-responsive element (ABRE). Mediates stress-responsive ABA signaling. {ECO:0000269|PubMed:11884679, ECO:0000269|PubMed:15361142}. |
| Regulation -- Description ? help
Back to Top |
| Source |
Description |
| UniProt | INDUCTION: Up-regulated by drought, salt, abscisic acid (ABA). {ECO:0000269|PubMed:10636868, ECO:0000269|PubMed:16284313}. |
| Publications
? help Back to Top |
- Zhao Q, et al.
Regulation and function of Arabidopsis AtGALK2 gene in abscisic acid response signaling.
Mol. Biol. Rep., 2018.
[PMID:24078097] - Bao Y, et al.
The tumor necrosis factor receptor-associated factor (TRAF)-like family protein SEVEN IN ABSENTIA 2 (SINA2) promotes drought tolerance in an ABA-dependent manner in Arabidopsis.
New Phytol., 2014. 202(1): p. 174-87
[PMID:24350984] - González-Grandío E,Cubas P
Identification of gene functions associated to active and dormant buds in Arabidopsis.
Plant Signal Behav, 2014. 9(2): p. e27994
[PMID:24518068] - Xie M, et al.
AtWNK9 is regulated by ABA and dehydration and is involved in drought tolerance in Arabidopsis.
Plant Physiol. Biochem., 2014. 77: p. 73-83
[PMID:24561249] - Kim EY,Seo YS,Park KY,Kim SJ,Kim WT
Overexpression of CaDSR6 increases tolerance to drought and salt stresses in transgenic Arabidopsis plants.
Gene, 2014. 552(1): p. 146-54
[PMID:25234727] - Zhang H, et al.
The RING finger ubiquitin E3 ligase SDIR1 targets SDIR1-INTERACTING PROTEIN1 for degradation to modulate the salt stress response and ABA signaling in Arabidopsis.
Plant Cell, 2015. 27(1): p. 214-27
[PMID:25616872] - Baek D, et al.
A Role for Arabidopsis miR399f in Salt, Drought, and ABA Signaling.
Mol. Cells, 2016. 39(2): p. 111-8
[PMID:26674968] - Bao Y, et al.
Overexpression of the NDR1/HIN1-Like Gene NHL6 Modifies Seed Germination in Response to Abscisic Acid and Abiotic Stresses in Arabidopsis.
PLoS ONE, 2016. 11(2): p. e0148572
[PMID:26849212] - Gao S, et al.
ABF2, ABF3, and ABF4 Promote ABA-Mediated Chlorophyll Degradation and Leaf Senescence by Transcriptional Activation of Chlorophyll Catabolic Genes and Senescence-Associated Genes in Arabidopsis.
Mol Plant, 2016. 9(9): p. 1272-1285
[PMID:27373216] - Li X, et al.
Dual Function of NAC072 in ABF3-Mediated ABA-Responsive Gene Regulation in Arabidopsis.
Front Plant Sci, 2016. 7: p. 1075
[PMID:27486475] - Wang Z, et al.
Overexpressing Arabidopsis ABF3 increases tolerance to multiple abiotic stresses and reduces leaf size in alfalfa.
Plant Physiol. Biochem., 2016. 109: p. 199-208
[PMID:27721135] - Song L, et al.
A transcription factor hierarchy defines an environmental stress response network.
Science, 2017.
[PMID:27811239] - Kerr TCC, et al.
Ectopic expression of two AREB/ABF orthologs increases drought tolerance in cotton (Gossypium hirsutum).
Plant Cell Environ., 2018. 41(5): p. 898-907
[PMID:28098349] - Lyzenga WJ,Sullivan V,Liu H,Stone SL
The Kinase Activity of Calcineurin B-like Interacting Protein Kinase 26 (CIPK26) Influences Its Own Stability and that of the ABA-regulated Ubiquitin Ligase, Keep on Going (KEG).
Front Plant Sci, 2017. 8: p. 502
[PMID:28443108] - Song C,Kim T,Chung WS,Lim CO
The Arabidopsis Phytocystatin AtCYS5 Enhances Seed Germination and Seedling Growth under Heat Stress Conditions.
Mol. Cells, 2017. 40(8): p. 577-586
[PMID:28756655] - Fernando VCD,Al Khateeb W,Belmonte MF,Schroeder DF
Role of Arabidopsis ABF1/3/4 during det1 germination in salt and osmotic stress conditions.
Plant Mol. Biol., 2018. 97(1-2): p. 149-163
[PMID:29680877] - Kim HJ, et al.
Confirmation of Drought Tolerance of Ectopically Expressed AtABF3 Gene in Soybean.
Mol. Cells, 2018. 41(5): p. 413-422
[PMID:29754472]
|
