PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Neem_2190_a_2

Organism

Azadirachta indica

Taxonomic ID

124943

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta

Family

M-type_MADS

Protein Properties

Length: 67aa MW: 7772.11 Da PI: 10.6673

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Neem_2190_a_2	genome	NGD	View Nucleic Acid

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.6	5.8e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELS+LCdaev +iifss+gklye++s Neem_2190_a_2 9 KRIENKINRQVTFAKRRNGLLKKAYELSILCDAEVGLIIFSSRGKLYEFCS 59 79***********************************************96 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	1.0E-40	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	32.983	1	61	IPR002100	Transcription factor, MADS-box
CDD	cd00265	3.59E-38	2	66	No hit	No description
SuperFamily	SSF55455	7.33E-31	2	64	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-33	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	2.7E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	2.1E-33	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 67 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSILCD AEVGLIIFSS RGKLYEFCSN 60 SRSMVYN

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
5f28_A	4e-20	1	65	1	65	MEF2C
5f28_B	4e-20	1	65	1	65	MEF2C
5f28_C	4e-20	1	65	1	65	MEF2C
5f28_D	4e-20	1	65	1	65	MEF2C
6byy_A	4e-20	1	65	1	65	MEF2 CHIMERA
6byy_B	4e-20	1	65	1	65	MEF2 CHIMERA
6byy_C	4e-20	1	65	1	65	MEF2 CHIMERA
6byy_D	4e-20	1	65	1	65	MEF2 CHIMERA
6bz1_A	4e-20	1	65	1	65	MEF2 CHIMERA
6bz1_B	4e-20	1	65	1	65	MEF2 CHIMERA
6bz1_C	4e-20	1	65	1	65	MEF2 CHIMERA
6bz1_D	4e-20	1	65	1	65	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	MADS-box transcription factor that acts redundantly with J2 to control meristem maturation and inflorescence architecture. {ECO:0000269\|PubMed:28528644}.
UniProt	Probable transcription factor involved in flower development. {ECO:0000250\|UniProtKB:Q0HA25}.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_027099546.1	3e-35	agamous-like MADS-box protein AGL9 homolog isoform X1
Refseq	XP_027099548.1	2e-35	agamous-like MADS-box protein AGL9 homolog isoform X3
Refseq	XP_027154053.1	2e-35	agamous-like MADS-box protein AGL9 homolog isoform X1
Refseq	XP_028764889.1	3e-35	developmental protein SEPALLATA 1-like isoform X1
Swissprot	Q7Y040	6e-35	EJ2_SOLLC; MADS-box protein EJ2
Swissprot	Q8LLR2	4e-35	MADS2_VITVI; Agamous-like MADS-box protein MADS2
TrEMBL	A0A2N9HF95	3e-35	A0A2N9HF95_FAGSY; Uncharacterized protein
STRING	cassava4.1_033922m	4e-36	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Malvids	OGEM78	28	413

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.3	5e-37	MIKC_MADS family protein

Publications ? help Back to Top
Jaillon O, et al. The grapevine genome sequence suggests ancestral hexaploidization in major angiosperm phyla. Nature, 2007. 449(7161): p. 463-7 [PMID:17721507] Díaz-Riquelme J,Lijavetzky D,Martínez-Zapater JM,Carmona MJ Genome-wide analysis of MIKCC-type MADS box genes in grapevine. Plant Physiol., 2009. 149(1): p. 354-69 [PMID:18997115] Tomato Genome Consortium The tomato genome sequence provides insights into fleshy fruit evolution. Nature, 2012. 485(7400): p. 635-41 [PMID:22660326] Grimplet J,Martínez-Zapater JM,Carmona MJ Structural and functional annotation of the MADS-box transcription factor family in grapevine. BMC Genomics, 2016. 17: p. 80 [PMID:26818751] Soyk S, et al. Bypassing Negative Epistasis on Yield in Tomato Imposed by a Domestication Gene. Cell, 2017. 169(6): p. 1142-1155.e12 [PMID:28528644]