![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_19819_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 166aa MW: 18903.4 Da PI: 10.494 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 109.5 | 1.6e-34 | 15 | 73 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vkg+++prsYY+Ct++gC+v+k+ver+++dpk+v++tYeg+Hnh+ Neem_19819_f_1 15 LDDGYRWRKYGQKVVKGNPYPRSYYKCTTPGCNVRKHVERASTDPKAVVTTYEGKHNHD 73 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 1.5E-37 | 2 | 75 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 1.57E-30 | 7 | 75 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 38.744 | 10 | 75 | IPR003657 | WRKY domain |
SMART | SM00774 | 2.4E-39 | 15 | 74 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.0E-26 | 16 | 73 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 166 aa Download sequence Send to blast |
EPRIIVQTTS EVDLLDDGYR WRKYGQKVVK GNPYPRSYYK CTTPGCNVRK HVERASTDPK 60 AVVTTYEGKH NHDVPAAKSS SHNTANNNAS QIQPQNARTD FGNNNQQPVA RLRHDKRPQD 120 KQKRRSAVIR HVFKNLFLTL MAIVFIMLLE KAFPETSMDI AIAKNG |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-47 | 6 | 76 | 8 | 78 | Probable WRKY transcription factor 4 |
2lex_A | 1e-47 | 6 | 76 | 8 | 78 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 119 | 124 | DKQKRR |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By salicylic acid and during leaf senescence. {ECO:0000269|PubMed:11449049, ECO:0000269|PubMed:11722756}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021299606.1 | 4e-66 | probable WRKY transcription factor 3 | ||||
Swissprot | Q9ZQ70 | 1e-55 | WRKY3_ARATH; Probable WRKY transcription factor 3 | ||||
TrEMBL | G3FFB0 | 2e-72 | G3FFB0_9ROSI; WRKY transcription factor 2-4 | ||||
STRING | EOY01812 | 3e-64 | (Theobroma cacao) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1534 | 27 | 92 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03340.1 | 4e-52 | WRKY DNA-binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|