PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_17448_f_2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 79aa MW: 8673.64 Da PI: 5.02 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 34.9 | 3.7e-11 | 36 | 67 | 1 | 32 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmg 32 rg+WT eEd +l+++++ +G g+W++ ar+ g Neem_17448_f_2 36 RGPWTVEEDFKLINYIANHGEGRWNSLARCAG 67 89****************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.10.60 | 4.0E-11 | 28 | 65 | IPR009057 | Homeodomain-like |
PROSITE profile | PS51294 | 10.503 | 31 | 79 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 2.39E-9 | 31 | 67 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 5.2E-4 | 35 | 75 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.3E-8 | 36 | 67 | IPR001005 | SANT/Myb domain |
CDD | cd00167 | 1.66E-6 | 38 | 67 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 79 aa Download sequence Send to blast |
MEVKAAAGGG RSGYCSSSSN SSIQSDQESA DMDLRRGPWT VEEDFKLINY IANHGEGRWN 60 SLARCAGFFL KVLKETDLL |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor contributing to the regulation of stamen maturation and male fertility in response to jasmonate signaling. Required for correct timing of anther dehiscence. Acts as a negative regulator of abscisic acid-induced cell death. Not involved in the regulation of BOI. Regulated by MYB21 and at a lower level by MYB24. Negatively regulated by the proteasome in an SCF(COI1) E3 ubiquitin-protein ligase complex-dependent manner. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873, ECO:0000269|PubMed:20921156, ECO:0000269|PubMed:23952703}. |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: Up-regulated by jasmonate and pathogen infection. {ECO:0000269|PubMed:14555693, ECO:0000269|PubMed:19091873}. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_007227100.1 | 2e-20 | transcription factor MYB108 | ||||
Swissprot | Q9LDE1 | 9e-17 | MY108_ARATH; Transcription factor MYB108 | ||||
TrEMBL | M1AGY2 | 5e-20 | M1AGY2_SOLTU; Uncharacterized protein | ||||
TrEMBL | M5XQV5 | 4e-19 | M5XQV5_PRUPE; Uncharacterized protein | ||||
STRING | EMJ28299 | 7e-20 | (Prunus persica) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G49620.1 | 7e-19 | myb domain protein 78 |
Publications ? help Back to Top | |||
---|---|---|---|
|