![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
| Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
| Basic Information? help Back to Top | |||||||||
|---|---|---|---|---|---|---|---|---|---|
| TF ID | Neem_16015_f_1 | ||||||||
| Organism | |||||||||
| Taxonomic ID | |||||||||
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
| Family | NAC | ||||||||
| Protein Properties | Length: 72aa MW: 7940.84 Da PI: 11.5053 | ||||||||
| Description | NAC family protein | ||||||||
| Gene Model |
|
||||||||
| Signature Domain? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
| 1 | NAM | 37.2 | 8.9e-12 | 2 | 43 | 87 | 128 |
NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128
g +++v+++ ++ vg kk +vf g+ap g+kt+W+m+eyrl
Neem_16015_f_1 2 GMEEPVFTRANRRVGSKKYFVFQLGEAPAGVKTNWIMQEYRL 43
778999**99******************************97 PP
| |||||||
| Protein Features ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Database | Entry ID | E-value | Start | End | InterPro ID | Description |
| PROSITE profile | PS51005 | 15.185 | 1 | 64 | IPR003441 | NAC domain |
| SuperFamily | SSF101941 | 9.81E-13 | 2 | 50 | IPR003441 | NAC domain |
| Pfam | PF02365 | 2.3E-4 | 14 | 43 | IPR003441 | NAC domain |
| Gene Ontology ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| GO Term | GO Category | GO Description | ||||
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
| GO:0003677 | Molecular Function | DNA binding | ||||
| Sequence ? help Back to Top |
|---|
| Protein Sequence Length: 72 aa Download sequence Send to blast |
MGMEEPVFTR ANRRVGSKKY FVFQLGEAPA GVKTNWIMQE YRLLDSTTGS ASSSSSSSSR 60 SSSKRRGNSR TT |
| Annotation -- Protein ? help Back to Top | |||||||
|---|---|---|---|---|---|---|---|
| Source | Hit ID | E-value | Description | ||||
| Refseq | XP_021896566.1 | 2e-19 | NAC domain-containing protein 104 | ||||
| TrEMBL | A0A067EYC8 | 2e-15 | A0A067EYC8_CITSI; Uncharacterized protein | ||||
| TrEMBL | A0A1U8B3S0 | 2e-15 | A0A1U8B3S0_NELNU; NAC domain-containing protein 104-like | ||||
| TrEMBL | A0A2H5PUU0 | 2e-15 | A0A2H5PUU0_CITUN; Uncharacterized protein | ||||
| TrEMBL | V4SY37 | 2e-15 | V4SY37_9ROSI; Uncharacterized protein | ||||
| STRING | evm.model.supercontig_63.29 | 8e-19 | (Carica papaya) | ||||
| Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
|---|---|---|---|---|---|---|
| Hit ID | E-value | Description | ||||
| AT1G61110.1 | 9e-12 | NAC domain containing protein 25 | ||||




