PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_12508_f_1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | bZIP | ||||||||
Protein Properties | Length: 130aa MW: 15007 Da PI: 10.8746 | ||||||||
Description | bZIP family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | bZIP_1 | 47.9 | 2.9e-15 | 85 | 127 | 5 | 47 |
CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS bZIP_1 5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkk 47 +r++r++kNRe+A rsR+RK+a++ eLe+kv Le+eN++L+ Neem_12508_f_1 85 RRQKRMIKNRESAARSRARKQAYTHELENKVSRLEEENERLRR 127 79***************************************95 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.20.5.170 | 7.4E-15 | 79 | 128 | No hit | No description |
SMART | SM00338 | 6.5E-7 | 81 | 128 | IPR004827 | Basic-leucine zipper domain |
PROSITE profile | PS50217 | 11.691 | 83 | 128 | IPR004827 | Basic-leucine zipper domain |
Pfam | PF00170 | 6.0E-13 | 85 | 127 | IPR004827 | Basic-leucine zipper domain |
CDD | cd14707 | 2.42E-20 | 85 | 128 | No hit | No description |
SuperFamily | SSF57959 | 6.06E-11 | 85 | 128 | No hit | No description |
PROSITE pattern | PS00036 | 0 | 88 | 103 | IPR004827 | Basic-leucine zipper domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 130 aa Download sequence Send to blast |
MQYQLPSVQP HPQQQHQQNL MAVYMPTHSI QQSLPVSANP ILDSQYPESQ MNMSPSSLMG 60 TLSDTQTPGR KRVAPGGVAE KTVERRQKRM IKNRESAARS RARKQAYTHE LENKVSRLEE 120 ENERLRRQRV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Binds to the embryo specification element and the ABA-responsive element (ABRE) of the Dc3 gene promoter. Could participate in abscisic acid-regulated gene expression during seed development. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_024955672.1 | 5e-68 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Refseq | XP_024955673.1 | 5e-68 | ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
Swissprot | Q9LES3 | 4e-39 | AI5L2_ARATH; ABSCISIC ACID-INSENSITIVE 5-like protein 2 | ||||
TrEMBL | A0A067F1G5 | 1e-68 | A0A067F1G5_CITSI; Uncharacterized protein | ||||
STRING | XP_006430421.1 | 8e-67 | (Citrus clementina) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM1884 | 28 | 83 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G56850.1 | 8e-33 | ABA-responsive element binding protein 3 |
Publications ? help Back to Top | |||
---|---|---|---|
|