![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Neem_11316_f_3 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Sapindales; Meliaceae; Azadirachta
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 117aa MW: 13062.1 Da PI: 8.8402 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 126.4 | 1.3e-39 | 7 | 106 | 1 | 100 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 +CaaCk+lrr+C++dC+++pyfpa++p++fa vhk++G snv k+l++lp + r +a++++ +eA+ r++dPvyG+vg+i+ l+qq++ ++++la Neem_11316_f_3 7 RCAACKYLRRRCPSDCIFSPYFPASNPRRFAWVHKIYGSSNVAKMLQQLPVHLRAEAAECISFEAQRRVEDPVYGCVGIISLLHQQIHDAESQLA 101 6********************************************************************************************** PP DUF260 96 llkee 100 ++k+e Neem_11316_f_3 102 KAKAE 106 *9987 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 23.66 | 6 | 107 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 3.8E-39 | 7 | 104 | IPR004883 | Lateral organ boundaries, LOB |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0016020 | Cellular Component | membrane |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 117 aa Download sequence Send to blast |
MSGVTGRCAA CKYLRRRCPS DCIFSPYFPA SNPRRFAWVH KIYGSSNVAK MLQQLPVHLR 60 AEAAECISFE AQRRVEDPVY GCVGIISLLH QQIHDAESQL AKAKAELAVL NSRDAQL |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 1e-37 | 3 | 107 | 7 | 111 | LOB family transfactor Ramosa2.1 |
5ly0_B | 1e-37 | 3 | 107 | 7 | 111 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00381 | DAP | Transfer from AT3G26620 | Download |
![]() |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_002318256.2 | 2e-62 | LOB domain-containing protein 24 | ||||
Swissprot | P59468 | 2e-49 | LBD24_ARATH; LOB domain-containing protein 24 | ||||
TrEMBL | B9I4F9 | 4e-61 | B9I4F9_POPTR; Uncharacterized protein | ||||
STRING | POPTR_0012s13910.1 | 7e-62 | (Populus trichocarpa) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Malvids | OGEM131 | 28 | 340 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT3G26660.1 | 9e-52 | LOB domain-containing protein 24 |