PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.O00333.1.p | ||||||||
Common Name | MIMGU_mgv11b020310mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 112aa MW: 12543.9 Da PI: 6.5082 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 53.8 | 4.6e-17 | 16 | 66 | 44 | 94 |
NF-YB 44 sfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrele 94 sfvt+ea+ c+r+ r t++++d+l a+a+lG++dy+epl+++l+k+r + Migut.O00333.1.p 16 SFVTAEANGWCNRDYRSTVTPEDVLAAMASLGLDDYLEPLTLFLNKHRAEQ 66 9**********************************************9754 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 7.9E-16 | 16 | 73 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.82E-13 | 16 | 74 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 1.3E-5 | 26 | 44 | No hit | No description |
PRINTS | PR00615 | 1.3E-5 | 45 | 63 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MPPTFRSPHR TLSANSFVTA EANGWCNRDY RSTVTPEDVL AAMASLGLDD YLEPLTLFLN 60 KHRAEQNSEQ GSMNFLPQFV RQGGDADASI GFIDTQQPQR THTVHRSTKY W* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-15 | 16 | 63 | 49 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.O00333.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012839452.1 | 1e-52 | PREDICTED: nuclear transcription factor Y subunit B-9-like | ||||
Swissprot | Q84W66 | 3e-14 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A022RVM3 | 8e-79 | A0A022RVM3_ERYGU; Uncharacterized protein |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 6e-17 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.O00333.1.p |