![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.N02807.1.p | ||||||||
Common Name | MIMGU_mgv1a025701mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | TALE | ||||||||
Protein Properties | Length: 153aa MW: 17567.7 Da PI: 7.7089 | ||||||||
Description | TALE family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Homeobox | 31.7 | 2.6e-10 | 79 | 114 | 20 | 55 |
HHSSS--HHHHHHHHHHCTS-HHHHHHHHHHHHHHH CS Homeobox 20 eknrypsaeereeLAkklgLterqVkvWFqNrRake 55 +k +yps++e+ LA+++gL+++q+ +WF N+R ++ Migut.N02807.1.p 79 YKWPYPSESEKVALAESTGLDQKQINNWFINQRKRH 114 5679*****************************985 PP | |||||||
2 | ELK | 37.6 | 4.5e-13 | 34 | 55 | 1 | 22 |
ELK 1 ELKhqLlrKYsgyLgsLkqEFs 22 ELK++Ll+KYsgyL+sLkqE+s Migut.N02807.1.p 34 ELKNHLLKKYSGYLSSLKQELS 55 9*******************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51213 | 11.243 | 34 | 54 | IPR005539 | ELK domain |
SMART | SM01188 | 1.0E-6 | 34 | 55 | IPR005539 | ELK domain |
Pfam | PF03789 | 2.2E-10 | 34 | 55 | IPR005539 | ELK domain |
PROSITE profile | PS50071 | 12.957 | 54 | 117 | IPR001356 | Homeobox domain |
SuperFamily | SSF46689 | 1.97E-20 | 55 | 130 | IPR009057 | Homeodomain-like |
SMART | SM00389 | 2.8E-13 | 56 | 121 | IPR001356 | Homeobox domain |
Gene3D | G3DSA:1.10.10.60 | 3.2E-28 | 59 | 120 | IPR009057 | Homeodomain-like |
CDD | cd00086 | 9.61E-13 | 66 | 118 | No hit | No description |
Pfam | PF05920 | 2.6E-17 | 74 | 113 | IPR008422 | Homeobox KN domain |
PROSITE pattern | PS00027 | 0 | 92 | 115 | IPR017970 | Homeobox, conserved site |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 153 aa Download sequence Send to blast |
DKCEGVGSSE DDQDNNSGGE TGQPEIDPRA EDRELKNHLL KKYSGYLSSL KQELSKKKKK 60 GKLPKDARQK LLSWWELHYK WPYPSESEKV ALAESTGLDQ KQINNWFINQ RKRHWKPSED 120 MQFMVMDGLH PQSGALYMEG HYMGEGPYRL GP* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Appears to be involved in meristem formation and in the regulation of leaf morphology. Misexpression makes the leaf more compound which is always associated with growth retardation and loss of apical dominance, resulting in dwarfed, bushy plants. Probably binds to the DNA sequence 5'-TGAC-3'. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.N02807.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012838803.1 | 1e-108 | PREDICTED: homeotic protein knotted-1 | ||||
Swissprot | Q41330 | 7e-91 | KN1_SOLLC; Homeotic protein knotted-1 | ||||
TrEMBL | A0A022R7G5 | 1e-108 | A0A022R7G5_ERYGU; Uncharacterized protein (Fragment) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA4973 | 23 | 33 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G08150.1 | 3e-73 | KNOTTED-like from Arabidopsis thaliana |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.N02807.1.p |