![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.N02066.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 144aa MW: 16261.1 Da PI: 4.6347 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 133.2 | 8.3e-42 | 6 | 98 | 5 | 97 |
NF-YB 5 drflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 + lPianv+++mkk+lP akis++ ke +q+c+sefi fvt+ea+++c++e+rkt++gdd++wal++lGf++y e++ yl+++re+e+e+ Migut.N02066.1.p 6 ELSLPIANVGQMMKKILPPSAKISREGKERMQQCASEFICFVTGEAAHRCRKENRKTVTGDDICWALSSLGFDNYSETMLRYLENFREFERER 98 5679**************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 3.0E-41 | 4 | 116 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.83E-34 | 6 | 123 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.3E-21 | 8 | 72 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.2E-12 | 36 | 54 | No hit | No description |
PRINTS | PR00615 | 2.2E-12 | 55 | 73 | No hit | No description |
PRINTS | PR00615 | 2.2E-12 | 74 | 92 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 144 aa Download sequence Send to blast |
MNDEIELSLP IANVGQMMKK ILPPSAKISR EGKERMQQCA SEFICFVTGE AAHRCRKENR 60 KTVTGDDICW ALSSLGFDNY SETMLRYLEN FREFERERAN QNNKVNNNCS EEKDEEISYG 120 DNTTSTPSFD FGILERGGTS LAN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-31 | 9 | 93 | 13 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.N02066.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012850788.1 | 3e-78 | PREDICTED: nuclear transcription factor Y subunit B-4-like | ||||
Swissprot | O04027 | 6e-42 | NFYB4_ARATH; Nuclear transcription factor Y subunit B-4 | ||||
TrEMBL | A0A022QJW4 | 5e-79 | A0A022QJW4_ERYGU; Uncharacterized protein | ||||
STRING | Migut.N02066.1.p | 1e-103 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA111 | 24 | 356 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G47810.1 | 6e-36 | nuclear factor Y, subunit B5 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.N02066.1.p |
Publications ? help Back to Top | |||
---|---|---|---|
|