PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.M00679.1.p | ||||||||
Common Name | MIMGU_mgv1a023556mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 105aa MW: 12129.8 Da PI: 7.5138 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 123.3 | 9.7e-39 | 1 | 88 | 8 | 95 |
NF-YB 8 lPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +Pi+n++rim++vlPa+a+i++dake +qecvsefisf+t+ea+ +c+r+ r+t++++d+l + +lGf+dy+epl+++l+k+r +g Migut.M00679.1.p 1 MPISNITRIMRRVLPAHARITDDAKEAIQECVSEFISFITTEANRRCHRDYRNTVTPEDVLATTVSLGFDDYLEPLTLFLNKHRTQQG 88 8***********************************************************************************8765 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Pfam | PF00808 | 1.3E-20 | 1 | 61 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
Gene3D | G3DSA:1.10.20.10 | 8.9E-37 | 1 | 91 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.13E-29 | 1 | 92 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 5.5E-14 | 28 | 46 | No hit | No description |
PRINTS | PR00615 | 5.5E-14 | 47 | 65 | No hit | No description |
PRINTS | PR00615 | 5.5E-14 | 66 | 84 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 105 aa Download sequence Send to blast |
MPISNITRIM RRVLPAHARI TDDAKEAIQE CVSEFISFIT TEANRRCHRD YRNTVTPEDV 60 LATTVSLGFD DYLEPLTLFL NKHRTQQGPD RDSTIQLPQF VRRGI |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 4e-40 | 1 | 84 | 13 | 96 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.M00679.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012836455.1 | 6e-66 | PREDICTED: nuclear transcription factor Y subunit B-6-like | ||||
Swissprot | Q84W66 | 5e-39 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A022RDA7 | 7e-68 | A0A022RDA7_ERYGU; Uncharacterized protein | ||||
STRING | Migut.M00679.1.p | 1e-72 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA6044 | 4 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 1e-41 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.M00679.1.p |