PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Migut.K00993.1.p | ||||||||
Common Name | LOC105967729, MIMGU_mgv1a012899mg | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 237aa MW: 26872.1 Da PI: 9.526 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 166.5 | 8.9e-52 | 15 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrFhPtdeelvv+yLk+kv++++l++ ++i++v++++++PwdLp +e+e yfFskr+ ky++g+r+nrat sgyWkatg dk+++ Migut.K00993.1.p 15 LPPGFRFHPTDEELVVQYLKRKVQSSPLPA-SIIPHVNVCNSDPWDLP---GDSEQERYFFSKREVKYPNGNRSNRATGSGYWKATGLDKKIV 103 79****************************.89***************...3467899*********************************** PP NAM 94 sk...kgelvglkktLvfykgrapkgektdWvmheyrl 128 s+ ++ vg+kktLvfy+g+ pkg +tdWvmhe+rl Migut.K00993.1.p 104 SSknnEEIIVGMKKTLVFYRGKPPKGCRTDWVMHEFRL 141 985444444***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 6.28E-60 | 12 | 165 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 56.47 | 15 | 165 | IPR003441 | NAC domain |
Pfam | PF02365 | 1.2E-27 | 16 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0009651 | Biological Process | response to salt stress | ||||
GO:0009737 | Biological Process | response to abscisic acid | ||||
GO:0010089 | Biological Process | xylem development | ||||
GO:0010150 | Biological Process | leaf senescence | ||||
GO:0045892 | Biological Process | negative regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 237 aa Download sequence Send to blast |
MEKLNPVKNG GALRLPPGFR FHPTDEELVV QYLKRKVQSS PLPASIIPHV NVCNSDPWDL 60 PGDSEQERYF FSKREVKYPN GNRSNRATGS GYWKATGLDK KIVSSKNNEE IIVGMKKTLV 120 FYRGKPPKGC RTDWVMHEFR LTTQQIQPNN LSLQENWVLC RIVLKRRNNK KNGDDVDASN 180 SGRVYYDFMG KERDADLTNS SSGSSGITEI SNRNESDDNE ESSSSCSTTF RRKEFP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1ut4_A | 2e-49 | 13 | 171 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut4_B | 2e-49 | 13 | 171 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_A | 2e-49 | 13 | 171 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
1ut7_B | 2e-49 | 13 | 171 | 15 | 171 | NO APICAL MERISTEM PROTEIN |
3swm_A | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swm_B | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swm_C | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swm_D | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swp_A | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swp_B | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swp_C | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
3swp_D | 2e-49 | 13 | 171 | 18 | 174 | NAC domain-containing protein 19 |
4dul_A | 2e-49 | 13 | 171 | 15 | 171 | NAC domain-containing protein 19 |
4dul_B | 2e-49 | 13 | 171 | 15 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Binding Motif ? help Back to Top | |||
---|---|---|---|
Motif ID | Method | Source | Motif file |
MP00507 | DAP | Transfer from AT5G13180 | Download |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Migut.K00993.1.p |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | Retrieve |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_012847799.1 | 1e-177 | PREDICTED: NAC transcription factor 25 | ||||
Swissprot | Q9FY93 | 2e-85 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | A0A022QIW0 | 1e-175 | A0A022QIW0_ERYGU; Uncharacterized protein | ||||
STRING | Migut.K00993.1.p | 1e-176 | (Erythranthe guttata) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Asterids | OGEA1387 | 23 | 77 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 1e-86 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Migut.K00993.1.p |
Entrez Gene | 105967729 |
Publications ? help Back to Top | |||
---|---|---|---|
|