 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
Migut.H01397.2.p |
Common Name | MIMGU_mgv1a017292mg |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe
|
Family |
M-type_MADS |
Protein Properties |
Length: 84aa MW: 9678 Da PI: 9.869 |
Description |
M-type_MADS family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
Migut.H01397.2.p | genome | JGI | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | SRF-TF | 102.3 | 1.7e-32 | 30 | 80 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51
krien++nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++g+lyeys+
Migut.H01397.2.p 30 KRIENTTNRQVTFCKRRNGLLKKAYELSVLCDAEVALIVFSTRGRLYEYSN 80
79***********************************************95 PP
|
3D Structure ? help Back to Top |
 |
PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
1tqe_P | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_Q | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_R | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
1tqe_S | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_A | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_B | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_C | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_D | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_E | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
6c9l_F | 1e-20 | 22 | 80 | 1 | 59 | Myocyte-specific enhancer factor 2B |
Search in ModeBase |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Probable transcription factor. Interacts genetically with TT16/AGL32 in a partially antagonistic manner during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). {ECO:0000269|PubMed:27776173}. |
Publications
? help Back to Top |
- Duarte JM, et al.
Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] - Pabón-Mora N,Wong GK,Ambrose BA
Evolution of fruit development genes in flowering plants. Front Plant Sci, 2014. 5: p. 300 [PMID:25018763] - Rathnakumar K, et al.
Angiopoietin-2 mediates thrombin-induced monocyte adhesion and endothelial permeability. J. Thromb. Haemost., 2016. 14(8): p. 1655-67 [PMID:27241812] - Balanzà V,Roig-Villanova I,Di Marzo M,Masiero S,Colombo L
Seed abscission and fruit dehiscence required for seed dispersal rely on similar genetic networks. Development, 2016. 143(18): p. 3372-81 [PMID:27510967] - Ehlers K, et al.
The MADS Box Genes ABS, SHP1, and SHP2 Are Essential for the Coordination of Cell Divisions in Ovule and Seed Coat Development and for Endosperm Formation in Arabidopsis thaliana. PLoS ONE, 2016. 11(10): p. e0165075 [PMID:27776173] - Sehra B,Franks RG
Redundant CArG Box Cis-motif Activity Mediates SHATTERPROOF2 Transcriptional Regulation during Arabidopsis thaliana Gynoecium Development. Front Plant Sci, 2017. 8: p. 1712 [PMID:29085379] - Ó'Maoiléidigh DS,Stewart D,Zheng B,Coupland G,Wellmer F
Floral homeotic proteins modulate the genetic program for leaf development to suppress trichome formation in flowers. Development, 2018. [PMID:29361563]
|