PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Migut.D00437.1.p

Common Name

LOC105957677, MIMGU_mgv1a020209mg

Organism

Mimulus guttatus

Taxonomic ID

4155

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Phrymaceae; Erythranthe

Family

NAC

Protein Properties

Length: 269aa MW: 30994.4 Da PI: 5.9038

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Migut.D00437.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	158.4	2.8e-49	10	138	1	129
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevl 93 lppGfrF P+deelv++yL kkv ++++ ++ e+d++ +ePw+Lp +k +++ewyfFs rd+kyatg r+nrat sgyWkatgkd++v+ Migut.D00437.1.p 10 LPPGFRFYPSDEELVCHYLYKKVCNEQILR-GTLVEIDLHVCEPWQLPDVAKLNSNEWYFFSFRDRKYATGFRANRATISGYWKATGKDRAVV 101 79***********************877.78***********87778899********************************* PP NAM 94 sk.kgelvglkktLvfykgrapkgektdWvmheyrle 129 + ++++vg++ktLvfy +rap+g kt W+mhe+rle Migut.D00437.1.p 102 DPkTRAVVGMRKTLVFYMNRAPNGIKTGWIMHEFRLE 138 9856778*************************985 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	5.75E-60	9	156	IPR003441	NAC domain
PROSITE profile	PS51005	56.758	10	156	IPR003441	NAC domain
Pfam	PF02365	4.3E-27	11	137	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 269 aa Download sequence Send to blast
MGLRDIGETL PPGFRFYPSD EELVCHYLYK KVCNEQILRG TLVEIDLHVC EPWQLPDVAK 60 LNSNEWYFFS FRDRKYATGF RANRATISGY WKATGKDRAV VDPKTRAVVG MRKTLVFYMN 120 RAPNGIKTGW IMHEFRLENP HVPPKEDWVL CRVFHKSRSG ENSSNLVDSP TYNNNNNIEQ 180 QIIMPNYGHQ NDTVSFYHTT PYHHLHQHGQ NPSTSIDPAV YVHVDNGDKM VDDDEAANNN 240 TYKCDVDNDY GFLFDFDDPD NNGDMGFN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	2e-48	9	162	16	171	NO APICAL MERISTEM PROTEIN
1ut4_B	2e-48	9	162	16	171	NO APICAL MERISTEM PROTEIN
1ut7_A	2e-48	9	162	16	171	NO APICAL MERISTEM PROTEIN
1ut7_B	2e-48	9	162	16	171	NO APICAL MERISTEM PROTEIN
3swm_A	3e-48	9	162	19	174	NAC domain-containing protein 19
3swm_B	3e-48	9	162	19	174	NAC domain-containing protein 19
3swm_C	3e-48	9	162	19	174	NAC domain-containing protein 19
3swm_D	3e-48	9	162	19	174	NAC domain-containing protein 19
3swp_A	3e-48	9	162	19	174	NAC domain-containing protein 19
3swp_B	3e-48	9	162	19	174	NAC domain-containing protein 19
3swp_C	3e-48	9	162	19	174	NAC domain-containing protein 19
3swp_D	3e-48	9	162	19	174	NAC domain-containing protein 19
4dul_A	2e-48	9	162	16	171	NAC domain-containing protein 19
4dul_B	2e-48	9	162	16	171	NAC domain-containing protein 19
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269\|PubMed:12837947, ECO:0000269\|PubMed:17122068}.
UniProt	Transcription activator of STM and KNAT6. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for the fusion of septa of gynoecia along the length of the ovaries. Activates the shoot formation in callus in a STM-dependent manner. Controls leaf margin development and required for leaf serration. Involved in axillary meristem initiation and separation of the meristem from the main stem. Regulates the phyllotaxy throughout the plant development. Seems to act as an inhibitor of cell division. {ECO:0000269\|PubMed:10079219, ECO:0000269\|PubMed:10750709, ECO:0000269\|PubMed:12163400, ECO:0000269\|PubMed:12492830, ECO:0000269\|PubMed:12610213, ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15500463, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16798887, ECO:0000269\|PubMed:17098808, ECO:0000269\|PubMed:17122068, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247, ECO:0000269\|PubMed:9212461}.
UniProt	Transcriptional activator that mediates auxin signaling to promote lateral root development. Activates the expression of two downstream auxin-responsive genes, DBP and AIR3. {ECO:0000269\|PubMed:11114891}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Migut.D00437.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By BRM and SYD, at the chromatin level, and conferring a very specific spatial expression pattern. Precise spatial regulation by post-transcriptional repression directed by the microRNA miR164. {ECO:0000269\|PubMed:15202996, ECO:0000269\|PubMed:15294871, ECO:0000269\|PubMed:15723790, ECO:0000269\|PubMed:16854978, ECO:0000269\|PubMed:17251269, ECO:0000269\|PubMed:17287247}.
UniProt	INDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269\|PubMed:16854978}.
UniProt	INDUCTION: Induced by auxin.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_012837084.1	0.0	PREDICTED: protein CUP-SHAPED COTYLEDON 3-like
Swissprot	O04017	2e-58	NAC98_ARATH; Protein CUP-SHAPED COTYLEDON 2
Swissprot	Q84TE6	7e-59	NAC22_ARATH; NAC domain-containing protein 21/22
Swissprot	Q9S851	1e-58	NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBL	A0A022S292	0.0	A0A022S292_ERYGU; Uncharacterized protein
STRING	Migut.D00437.1.p	0.0	(Erythranthe guttata)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Asterids	OGEA1882	24	66

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G28530.1	4e-91	NAC domain containing protein 74

Link Out ? help Back to Top
Phytozome	Migut.D00437.1.p
Entrez Gene	105957677

Publications ? help Back to Top
Le Hénanff G, et al. Grapevine NAC1 transcription factor as a convergent node in developmental processes, abiotic stresses, and necrotrophic/biotrophic pathogen tolerance. J. Exp. Bot., 2013. 64(16): p. 4877-93 [PMID:24043850] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Ding Y, et al. Four distinct types of dehydration stress memory genes in Arabidopsis thaliana. BMC Plant Biol., 2013. 13: p. 229 [PMID:24377444] Kamiuchi Y,Yamamoto K,Furutani M,Tasaka M,Aida M The CUC1 and CUC2 genes promote carpel margin meristem formation during Arabidopsis gynoecium development. Front Plant Sci, 2014. 5: p. 165 [PMID:24817871] Chen C, et al. Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.). J. Exp. Bot., 2014. 65(17): p. 4943-58 [PMID:24962999] Gonçalves B, et al. A conserved role for CUP-SHAPED COTYLEDON genes during ovule development. Plant J., 2015. 83(4): p. 732-42 [PMID:26119568] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Huo X,Wang C,Teng Y,Liu X Identification of miRNAs associated with dark-induced senescence in Arabidopsis. BMC Plant Biol., 2015. 15: p. 266 [PMID:26530097] Vialette-Guiraud AC, et al. A Conserved Role for the NAM/miR164 Developmental Module Reveals a Common Mechanism Underlying Carpel Margin Fusion in Monocarpous and Syncarpous Eurosids. Front Plant Sci, 2015. 6: p. 1239 [PMID:26793217] Chen X, et al. Auxin-Independent NAC Pathway Acts in Response to Explant-Specific Wounding and Promotes Root Tip Emergence during de Novo Root Organogenesis in Arabidopsis. Plant Physiol., 2016. 170(4): p. 2136-45 [PMID:26850273] Cui X, et al. REF6 recognizes a specific DNA sequence to demethylate H3K27me3 and regulate organ boundary formation in Arabidopsis. Nat. Genet., 2016. 48(6): p. 694-9 [PMID:27111035] Blein T,Pautot V,Laufs P Combinations of Mutations Sufficient to Alter Arabidopsis Leaf Dissection. Plants (Basel), 2013. 2(2): p. 230-47 [PMID:27137374] Biot E, et al. Multiscale quantification of morphodynamics: MorphoLeaf software for 2D shape analysis. Development, 2016. 143(18): p. 3417-28 [PMID:27387872] Zheng M, et al. Chloroplast Translation Initiation Factors Regulate Leaf Variegation and Development. Plant Physiol., 2016. 172(2): p. 1117-1130 [PMID:27535792] Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis. Plant J., 2017. 90(3): p. 435-446 [PMID:28161901] Espinosa-Ruiz A, et al. TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana. Development, 2017. 144(9): p. 1619-1628 [PMID:28320734] Koyama T,Sato F,Ohme-Takagi M Roles of miR319 and TCP Transcription Factors in Leaf Development. Plant Physiol., 2017. 175(2): p. 874-885 [PMID:28842549] González-Carranza ZH, et al. HAWAIIAN SKIRT controls size and floral organ number by modulating CUC1 and CUC2 expression. PLoS ONE, 2017. 12(9): p. e0185106 [PMID:28934292] Liu C,Wang B,Li Z,Peng Z,Zhang J TsNAC1 Is a Key Transcription Factor in Abiotic Stress Resistance and Growth. Plant Physiol., 2018. 176(1): p. 742-756 [PMID:29122985] Wilson-Sánchez D,Martínez-López S,Navarro-Cartagena S,Jover-Gil S,Micol JL Members of the DEAL subfamily of the DUF1218 gene family are required for bilateral symmetry but not for dorsoventrality in Arabidopsis leaves. New Phytol., 2018. 217(3): p. 1307-1321 [PMID:29139551] Gonçalves B, et al. GDP-L-fucose is required for boundary definition in plants. J. Exp. Bot., 2017. 68(21-22): p. 5801-5811 [PMID:29186469] Sha S, et al. To be serrate or pinnate: diverse leaf forms of yarrows (Achillea) are linked to differential expression patterns of NAM genes. Ann. Bot., 2018. 121(2): p. 255-266 [PMID:29267935] Maugarny-Calès A, et al. Dissecting the pathways coordinating patterning and growth by plant boundary domains. PLoS Genet., 2019. 15(1): p. e1007913 [PMID:30677017]