![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr8g091720.1 | ||||||||
Common Name | MTR_8g091720, NF-YB7 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 202aa MW: 22041.3 Da PI: 6.2758 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 181.2 | 8.7e-57 | 27 | 122 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +eqdrflPianvsrimk++lPanakisk+aketvqecvsefisf+t+easdkcqrekrktingddllwa++tlGfe+yv plkvyl++yre+eg Medtr8g091720.1 27 KEQDRFLPIANVSRIMKRALPANAKISKEAKETVQECVSEFISFITGEASDKCQREKRKTINGDDLLWAMTTLGFENYVGPLKVYLNNYREIEG 120 89******************************************************************************************** PP NF-YB 96 ek 97 ek Medtr8g091720.1 121 EK 122 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.3E-54 | 24 | 136 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 3.11E-41 | 29 | 143 | IPR009072 | Histone-fold |
Pfam | PF00808 | 2.2E-27 | 32 | 96 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.6E-18 | 60 | 78 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 63 | 79 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.6E-18 | 79 | 97 | No hit | No description |
PRINTS | PR00615 | 1.6E-18 | 98 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 202 aa Download sequence Send to blast |
MSGNKRNQTS PVGSPTSGNI SDSLSSKEQD RFLPIANVSR IMKRALPANA KISKEAKETV 60 QECVSEFISF ITGEASDKCQ REKRKTINGD DLLWAMTTLG FENYVGPLKV YLNNYREIEG 120 EKSNSSATKQ DDQYDHNSCS IDVNDLGGGF YAPKRFQEIN GGILDYRVIG QSVVNNGNSD 180 ETEHAIGSGN KNHATKPTLQ G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 2e-48 | 27 | 117 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 2e-48 | 27 | 117 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.24957 | 0.0 | root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr8g091720.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC202494 | 0.0 | AC202494.23 Medicago truncatula clone mth2-25j15, complete sequence. | |||
GenBank | JQ918280 | 0.0 | JQ918280.1 Medicago truncatula nuclear transcription factor Y subunit B7 (NF-YB7) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003630101.1 | 1e-149 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 4e-63 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | G7LB97 | 1e-148 | G7LB97_MEDTR; Nuclear transcription factor Y protein | ||||
STRING | AET04577 | 1e-149 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 2e-65 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr8g091720.1 |
Entrez Gene | 11436173 |
Publications ? help Back to Top | |||
---|---|---|---|
|