PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr7g061270.1

Common Name

MTR_7g061270

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NF-YB

Protein Properties

Length: 167aa MW: 18331.6 Da PI: 7.5064

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr7g061270.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	187.4	1.1e-58	25	121	2	98
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPian+srimkk+lPan+ki+kdaketvqecvsefisf+tseasdkcqrekrktingddllwa+atlGfedy++plk+yl++yre+eg Medtr7g061270.1 25 REQDRFLPIANISRIMKKALPANGKIAKDAKETVQECVSEFISFITSEASDKCQREKRKTINGDDLLWAMATLGFEDYIDPLKIYLTRYREMEG 118 89******************************************************************************************** PP NF-YB 96 ekk 98 ++k Medtr7g061270.1 119 DTK 121 975 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	2.3E-55	21	135	IPR009072	Histone-fold
SuperFamily	SSF47113	2.17E-41	27	132	IPR009072	Histone-fold
Pfam	PF00808	1.9E-28	30	94	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.4E-20	58	76	No hit	No description
PROSITE pattern	PS00685	0	61	77	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.4E-20	77	95	No hit	No description
PRINTS	PR00615	1.4E-20	96	114	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 167 aa Download sequence Send to blast
MSETPASPGG GSHESGEHSP RSNIREQDRF LPIANISRIM KKALPANGKI AKDAKETVQE 60 CVSEFISFIT SEASDKCQRE KRKTINGDDL LWAMATLGFE DYIDPLKIYL TRYREMEGDT 120 KGSAKGGDTS GKKDVQQGSN PQLVHQGSFS QGVSYTNSQV TLLSKML

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	5e-48	24	115	1	92	Transcription factor HapC (Eurofung)
4g92_B	5e-48	24	115	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.10804	0.0	flower\| root\| seed

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr7g061270.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ918275	0.0	JQ918275.1 Medicago truncatula nuclear transcription factor Y subunit B2 (NF-YB2) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_003623108.3	1e-122	nuclear transcription factor Y subunit B-1
Swissprot	Q8VYK4	9e-82	NFYB8_ARATH; Nuclear transcription factor Y subunit B-8
TrEMBL	G7L4J2	1e-122	G7L4J2_MEDTR; Nuclear transcription factor Y subunit B (Fragment)
STRING	AES79326	1e-118	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF2545	33	82

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT3G53340.1	1e-79	nuclear factor Y, subunit B10

Link Out ? help Back to Top
Phytozome	Medtr7g061270.1
Entrez Gene	11407040

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]