PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr5g049190.1 | ||||||||
Common Name | MTR_5g049190 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 243aa MW: 28246 Da PI: 6.7719 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.7 | 6.5e-19 | 19 | 65 | 1 | 48 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g WT eEd ll+++v+q+G + W+ Ia++++ gR +kqc++rw ++l Medtr5g049190.1 19 KGQWTLEEDRLLINLVEQYGLRKWTDIAQKLP-GRMGKQCRERWINHL 65 799*****************************.************996 PP | |||||||
2 | Myb_DNA-binding | 56.9 | 4.7e-18 | 73 | 113 | 3 | 45 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwq 45 W++eE+++l +a+++lG++ W +Ia++++ gRt++++k++w+ Medtr5g049190.1 73 IWSEEEEKILMKAHEELGNK-WVKIAKRLP-GRTENSIKNHWY 113 6*******************.*********.***********9 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 29.572 | 14 | 69 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 4.03E-32 | 16 | 112 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 3.8E-17 | 18 | 67 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 9.9E-28 | 20 | 72 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 3.91E-15 | 22 | 65 | No hit | No description |
Pfam | PF13921 | 3.9E-18 | 22 | 79 | No hit | No description |
SMART | SM00717 | 3.9E-16 | 70 | 118 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 19.917 | 70 | 120 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.2E-21 | 73 | 119 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.00E-12 | 74 | 116 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 243 aa Download sequence Send to blast |
MSYCKRVGMT RNNKSNIVKG QWTLEEDRLL INLVEQYGLR KWTDIAQKLP GRMGKQCRER 60 WINHLRPDIK KDIWSEEEEK ILMKAHEELG NKWVKIAKRL PGRTENSIKN HWYATKRREY 120 SKRNYPSGST LLQEYIKSLN LDKNPPKEYT RKSSTKASDS EYLLTNQSTI SAQSQKANDS 180 QCLLSSGDFE DDILDICFDD NLFQDGCSID SLLDDMQIVE DTMLGVDVKK ELDLIEFFYS 240 GQ* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1a5j_A | 2e-40 | 16 | 119 | 4 | 107 | B-MYB |
1gv2_A | 1e-40 | 17 | 119 | 2 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-40 | 17 | 119 | 2 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 1e-40 | 17 | 119 | 2 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed in cellularized but not uncellularized female gametophytes. {ECO:0000269|PubMed:16214903}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed at high levels in the synergid cells of the female gametophyte, and at lower levels in the endosperm of young seeds and the trichomes of young leaves and sepals. {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor that binds to the motif 5'-GTAACNT-3' in the promoter of target genes (e.g. DD11 and DD18) and promotes their expression within synergid cells (e.g. in the filiform apparatus) in ovules (PubMed:16214903, PubMed:17693534, PubMed:18410484, PubMed:17937500). Required for the formation of the filiform apparatus during synergid cell differentiation in the female gametophyte (PubMed:16214903). Involved in pollen tube guidance to the micropyle (PubMed:16214903, PubMed:17937500, PubMed:23093426). {ECO:0000269|PubMed:16214903, ECO:0000269|PubMed:17693534, ECO:0000269|PubMed:17937500, ECO:0000269|PubMed:18410484, ECO:0000269|PubMed:23093426}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr5g049190.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013453883.1 | 1e-180 | transcription factor MYB98 | ||||
Swissprot | Q9S7L2 | 5e-69 | MYB98_ARATH; Transcription factor MYB98 | ||||
TrEMBL | A0A072UDS4 | 1e-179 | A0A072UDS4_MEDTR; Transcription factor MYB98 | ||||
STRING | AES71503 | 1e-105 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1570 | 31 | 96 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G18770.1 | 2e-71 | myb domain protein 98 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr5g049190.1 |
Entrez Gene | 25494705 |
Publications ? help Back to Top | |||
---|---|---|---|
|