PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr4g133938.1

Common Name

MTR_4g133938, NF-YB8

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NF-YB

Protein Properties

Length: 137aa MW: 15333.4 Da PI: 5.0823

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr4g133938.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	170.5	1.9e-53	20	113	4	97
NF-YB 4 qdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelegek 97 q+r+lPianv+rimkk+lP++akisk+aket+qecvsefisf+t+eas+kcq+ekrktingddl+wa++tlGfe+y+eplk yl kyre+eg+k Medtr4g133938.1 20 QERLLPIANVGRIMKKALPTRAKISKEAKETMQECVSEFISFITGEASEKCQKEKRKTINGDDLVWAMTTLGFEEYAEPLKGYLLKYREIEGDK 113 89******************************************************************************************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	3.4E-50	19	122	IPR009072	Histone-fold
SuperFamily	SSF47113	1.34E-38	20	115	IPR009072	Histone-fold
Pfam	PF00808	6.8E-28	23	87	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	9.7E-20	51	69	No hit	No description
PROSITE pattern	PS00685	0	54	70	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	9.7E-20	70	88	No hit	No description
PRINTS	PR00615	9.7E-20	89	107	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 137 aa Download sequence Send to blast
MAESDDESGG QASGSRELLQ ERLLPIANVG RIMKKALPTR AKISKEAKET MQECVSEFIS 60 FITGEASEKC QKEKRKTING DDLVWAMTTL GFEEYAEPLK GYLLKYREIE GDKNFSMNMI 120 GSNKEQEGSI HRFFQG*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	4e-45	20	108	4	92	Transcription factor HapC (Eurofung)
4g92_B	4e-45	20	108	4	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- UniGene ? help Back to Top
UniGene ID	E-value	Expressed in
Mtr.26314	0.0	root

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr4g133938.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	JQ918281	0.0	JQ918281.1 Medicago truncatula nuclear trancsription factor Y subunit B8 (NF-YB8) mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_013458655.1	6e-97	nuclear transcription factor Y subunit B-3
Swissprot	O23310	3e-58	NFYB3_ARATH; Nuclear transcription factor Y subunit B-3
TrEMBL	I3TAW6	1e-95	I3TAW6_MEDTR; Nuclear trancsription factor Y subunit B8
STRING	XP_004507593.1	4e-75	(Cicer arietinum)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF591	34	150

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G14540.1	1e-60	nuclear factor Y, subunit B3

Link Out ? help Back to Top
Phytozome	Medtr4g133938.1
Entrez Gene	25494319

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Han X, et al. Overexpression of the poplar NF-YB7 transcription factor confers drought tolerance and improves water-use efficiency in Arabidopsis. J. Exp. Bot., 2013. 64(14): p. 4589-601 [PMID:24006421] Hwang YH, et al. Functional conservation of rice OsNF-YB/YC and Arabidopsis AtNF-YB/YC proteins in the regulation of flowering time. Plant Cell Rep., 2016. 35(4): p. 857-65 [PMID:26754793] Hossain MA, et al. Identification of Novel Components of the Unfolded Protein Response in Arabidopsis. Front Plant Sci, 2016. 7: p. 650 [PMID:27242851] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]