PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Medtr4g119500.1

Common Name

MTR_4g119500

Organism

Medicago truncatula

Taxonomic ID

3880

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago

Family

NF-YB

Protein Properties

Length: 130aa MW: 14750.5 Da PI: 5.3058

Description

NF-YB family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Medtr4g119500.1	genome	Mt	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NF-YB	174.1	1.5e-54	21	116	2	97
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 +eqdr+lPianv+rimk++lP+nakisk++ket+qecvsefisfvtseas+kc++e+rkt+ngdd++wal+tlGf+dy+ep++ yl++yrele Medtr4g119500.1 21 KEQDRLLPIANVGRIMKQILPQNAKISKESKETMQECVSEFISFVTSEASEKCRKERRKTVNGDDICWALGTLGFDDYAEPMRRYLHRYRELEV 114 89*******************************************************************************************9 PP NF-YB 96 ek 97 ++ Medtr4g119500.1 115 DR 116 87 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.20.10	4.6E-50	18	118	IPR009072	Histone-fold
SuperFamily	SSF47113	3.73E-38	23	118	IPR009072	Histone-fold
Pfam	PF00808	2.4E-27	26	90	IPR003958	Transcription factor CBF/NF-Y/archaeal histone domain
PRINTS	PR00615	1.9E-18	54	72	No hit	No description
PROSITE pattern	PS00685	0	57	73	IPR003956	Transcription factor, NFYB/HAP3, conserved site
PRINTS	PR00615	1.9E-18	73	91	No hit	No description
PRINTS	PR00615	1.9E-18	92	110	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0043565	Molecular Function	sequence-specific DNA binding
GO:0046982	Molecular Function	protein heterodimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 130 aa Download sequence Send to blast
MMDNNVGGSS FSNDENGGII KEQDRLLPIA NVGRIMKQIL PQNAKISKES KETMQECVSE 60 FISFVTSEAS EKCRKERRKT VNGDDICWAL GTLGFDDYAE PMRRYLHRYR ELEVDRTPTT 120 TNNIQDRGN*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4g91_B	3e-45	20	111	1	92	Transcription factor HapC (Eurofung)
4g92_B	3e-45	20	111	1	92	Transcription factor HapC (Eurofung)
Search in ModeBase

Expression -- Description ? help Back to Top
Source	Description
Uniprot	TISSUE SPECIFICITY: Expressed in flowers and siliques. {ECO:0000269\|PubMed:11250072}.

Functional Description ? help Back to Top
Source	Description
UniProt	Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Medtr4g119500.1

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC174371	0.0	AC174371.23 Medicago truncatula chromosome 8 clone mth2-50f21, complete sequence.
GenBank	BT137051	0.0	BT137051.1 Medicago truncatula clone JCVI-FLMt-1H17 unknown mRNA.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_024637540.1	8e-80	nuclear transcription factor Y subunit B-10
Swissprot	O82248	6e-55	NFYB5_ARATH; Nuclear transcription factor Y subunit B-5
TrEMBL	G7JKC3	6e-92	G7JKC3_MEDTR; Nuclear transcription factor Y protein
STRING	AES91843	2e-78	(Medicago truncatula)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF805	32	131

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G47810.1	3e-57	nuclear factor Y, subunit B5

Link Out ? help Back to Top
Phytozome	Medtr4g119500.1
Entrez Gene	11422870

Publications ? help Back to Top
Young ND, et al. The Medicago genome provides insight into the evolution of rhizobial symbioses. Nature, 2011. 480(7378): p. 520-4 [PMID:22089132] Zhao H, et al. The Arabidopsis thaliana Nuclear Factor Y Transcription Factors. Front Plant Sci, 2016. 7: p. 2045 [PMID:28119722]