![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr4g094982.1 | ||||||||
Common Name | MTR_4g094982 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MYB | ||||||||
Protein Properties | Length: 272aa MW: 29507.3 Da PI: 5.8248 | ||||||||
Description | MYB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 59.5 | 7.5e-19 | 5 | 50 | 1 | 47 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 +g+W++eEde l ++v ++G+++W++I+r ++ gR++k+c++rw + Medtr4g094982.1 5 KGPWSPEEDESLTKLVDRYGPRNWSLISRAIP-GRSGKSCRLRWCNQ 50 79******************************.***********985 PP | |||||||
2 | Myb_DNA-binding | 55 | 1.9e-17 | 59 | 101 | 3 | 47 |
SS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS Myb_DNA-binding 3 rWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 ++++eEd ++++a++q+G++ W+tIar + gRt++ +k++w++ Medtr4g094982.1 59 AFSPEEDNIIIRAHAQFGNK-WATIARLLS-GRTDNAIKNHWNST 101 79******************.*********.***********986 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 28.753 | 1 | 55 | IPR017930 | Myb domain |
SuperFamily | SSF46689 | 1.87E-31 | 2 | 98 | IPR009057 | Homeodomain-like |
SMART | SM00717 | 6.6E-16 | 4 | 53 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 1.0E-17 | 5 | 50 | IPR001005 | SANT/Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.8E-25 | 6 | 58 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 2.95E-15 | 7 | 49 | No hit | No description |
SMART | SM00717 | 9.3E-15 | 56 | 104 | IPR001005 | SANT/Myb domain |
PROSITE profile | PS51294 | 21.3 | 57 | 106 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 3.0E-23 | 59 | 105 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 1.74E-12 | 59 | 102 | No hit | No description |
Pfam | PF00249 | 1.9E-14 | 59 | 101 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 272 aa Download sequence Send to blast |
MDRIKGPWSP EEDESLTKLV DRYGPRNWSL ISRAIPGRSG KSCRLRWCNQ LSPQVEHRAF 60 SPEEDNIIIR AHAQFGNKWA TIARLLSGRT DNAIKNHWNS TLKRKCSSFI GSDDRDFNPQ 120 PLKRSASVGA PGSPSGSDLS DSGVQQTVFR PVPIRLPVET TSEPEPVTVP EAVEEDDGPL 180 TSLSLSLPGV DAAAAVLVSP APITAVTAVT VSEEAGIGAL NLSGEFMAVM QEMIKNEVRS 240 YMEERNGMCF QGVDRLRNVS AKPIGINRVD G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1gv2_A | 1e-41 | 4 | 105 | 3 | 104 | MYB PROTO-ONCOGENE PROTEIN |
1h88_C | 5e-41 | 4 | 105 | 57 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1h89_C | 5e-41 | 4 | 105 | 57 | 158 | MYB PROTO-ONCOGENE PROTEIN |
1mse_C | 1e-41 | 4 | 105 | 3 | 104 | C-Myb DNA-Binding Domain |
1msf_C | 1e-41 | 4 | 105 | 3 | 104 | C-Myb DNA-Binding Domain |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.13651 | 0.0 | leaf| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during very late stages of embryogenesis. Later, its expression follows a development dependent gradient in successive leaves. {ECO:0000269|PubMed:9678577}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, stems, leaves, inflorescence, and flowers (including stamen, floral nectar, carpel, petal and sepal), mostly in vasculatures and stomata. {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:9678577}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor (PubMed:23067202, PubMed:23603962). Represses the expression of protein phosphatases 2C in response to abscisic acid (ABA). Confers resistance to abiotic stresses dependent of ABA (PubMed:18162593, PubMed:9678577). In response to auxin, activates the transcription of the auxin-responsive gene IAA19. The IAA19 transcription activation by MYB44 is enhanced by direct interaction between MYB44 and PYL8 (PubMed:24894996). Transcriptional activator of WRKY70 by direct binding to its promoter region, especially at 5'-TAACNG-3' and 5'-CNGTTA-3' symmetric motifs (PubMed:23067202, PubMed:23603962). Activates salicylic acid (SA)- mediated defenses and subsequent resistance to biotrophic pathogen P.syringae pv. tomato DC3000, but represses jasmonic acid (JA)-mediated defenses responses against the necrotrophic pathogen A.brassicicola (PubMed:23067202). {ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202, ECO:0000269|PubMed:23603962, ECO:0000269|PubMed:24894996, ECO:0000269|PubMed:9678577}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr4g094982.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By drought, cold, high salinity, cadmium (CdCl(2)), salicylic acid (SA), jasmonate (JA), ethylene, gibberellic acid (GA), and ABA (PubMed:16463103, PubMed:18162593, PubMed:23067202). The induction by JA is COI1-dependent (PubMed:23067202). {ECO:0000269|PubMed:16463103, ECO:0000269|PubMed:18162593, ECO:0000269|PubMed:23067202}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT148844 | 0.0 | BT148844.1 Medicago truncatula clone JCVI-FLMt-14F12 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013457460.1 | 0.0 | transcription factor MYB44 | ||||
Swissprot | Q9FDW1 | 4e-82 | MYB44_ARATH; Transcription factor MYB44 | ||||
TrEMBL | A0A072UQ69 | 0.0 | A0A072UQ69_MEDTR; Myb transcription factor | ||||
STRING | XP_007155887.1 | 1e-129 | (Phaseolus vulgaris) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF843 | 34 | 124 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G37260.1 | 2e-66 | myb domain protein 73 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr4g094982.1 |
Entrez Gene | 25493498 |