PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Home  TFext  BLAST  Prediction  Download  Help  About  Links  PlantRegMap
(e.g., LFY)
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Medtr4g045757.1
Common NameMTR_4g045757
Organism
Medicago truncatula
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
Family HSF
Protein Properties Length: 80aa    MW: 9201.49 Da    PI: 8.9459
Description HSF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Medtr4g045757.1genomeMtView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1HSF_DNA-bind57.53.7e-181572259
                     HHHHHHHHHCTGGGTTTSEESSSSSEEEES-HHHHHHHTHHHHSTT--HHHHHHHHHH CS
     HSF_DNA-bind  2 FlkklyeiledeelkeliswsengnsfvvldeeefakkvLpkyFkhsnfaSFvRQLnm 59
                     Fl+k+y  ++ + ++ ++sws++++sf+v+++ +f +++LpkyFk++nf+ F+RQLn 
  Medtr4g045757.1 15 FLSKTYGKVDYPLTNVIVSWSATNRSFIVWNPVDFGEDLLPKYFKQNNFSNFIRQLNN 72
                     9********************999********************************84 PP
Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.104.1E-20872IPR011991Winged helix-turn-helix DNA-binding domain
SMARTSM004154.5E-61174IPR000232Heat shock factor (HSF)-type, DNA-binding
SuperFamilySSF467851.1E-141172IPR011991Winged helix-turn-helix DNA-binding domain
PfamPF004478.0E-151572IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.8E-91538IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.8E-95365IPR000232Heat shock factor (HSF)-type, DNA-binding
PRINTSPR000561.8E-96678IPR000232Heat shock factor (HSF)-type, DNA-binding
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 80 aa     Download sequence    Send to blast
MEVAQGSHFN HVPPFLSKTY GKVDYPLTNV IVSWSATNRS FIVWNPVDFG EDLLPKYFKQ  60
NNFSNFIRQL NNTYTLVMI*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5d8k_B4e-141171161Heat shock factor protein 2
5d8l_B4e-141171161Heat shock factor protein 2
5d8l_D4e-141171161Heat shock factor protein 2
5d8l_F4e-141171161Heat shock factor protein 2
5d8l_H4e-141171161Heat shock factor protein 2
Search in ModeBase
Expression -- Description ? help Back to Top
Source Description
UniprotTISSUE SPECIFICITY: Constitutively expressed. {ECO:0000269|PubMed:7948881}.
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that specifically binds DNA sequence 5'-AGAAnnTTCT-3' known as heat shock promoter elements (HSE).
Cis-element ? help Back to Top
SourceLink
PlantRegMapMedtr4g045757.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By heat stress. {ECO:0000269|PubMed:7948881}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqNP_001340393.18e-27heat stress transcription factor 31
RefseqXP_028204439.18e-27heat stress transcription factor A-4a-like
SwissprotP411516e-23HFA1A_ARATH; Heat stress transcription factor A-1a
TrEMBLA0A072UKF71e-51A0A072UKF7_MEDTR; Heat shock transcription factor
STRINGGLYMA15G09280.13e-26(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF15923395
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G17750.12e-25heat shock factor 1
Publications ? help Back to Top
  1. Hsu SF,Jinn TL
    AtHSBP functions in seed development and the motif is required for subcellular localization and interaction with AtHSFs.
    Plant Signal Behav, 2010. 5(8): p. 1042-4
    [PMID:20657173]
  2. Young ND, et al.
    The Medicago genome provides insight into the evolution of rhizobial symbioses.
    Nature, 2011. 480(7378): p. 520-4
    [PMID:22089132]
  3. Liu HC,Charng YY
    Common and distinct functions of Arabidopsis class A1 and A2 heat shock factors in diverse abiotic stress responses and development.
    Plant Physiol., 2013. 163(1): p. 276-90
    [PMID:23832625]
  4. Li S, et al.
    HEAT-INDUCED TAS1 TARGET1 Mediates Thermotolerance via HEAT STRESS TRANSCRIPTION FACTOR A1a-Directed Pathways in Arabidopsis.
    Plant Cell, 2014. 26(4): p. 1764-1780
    [PMID:24728648]
  5. Muench M,Hsin CH,Ferber E,Berger S,Mueller MJ
    Reactive electrophilic oxylipins trigger a heat stress-like response through HSFA1 transcription factors.
    J. Exp. Bot., 2016. 67(21): p. 6139-6148
    [PMID:27811081]