![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr3g102590.1 | ||||||||
Common Name | MTR_061s1022, MTR_133s1023, MTR_3g102590 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | ARR-B | ||||||||
Protein Properties | Length: 241aa MW: 27055.6 Da PI: 5.2058 | ||||||||
Description | ARR-B family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 73.9 | 2.3e-23 | 145 | 196 | 3 | 55 |
G2-like 3 rlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 + +W+ eLH++Fv av+qL G++kA+P +il lm+v+ +t+e+v+SHL kYRl Medtr3g102590.1 145 QSVWSVELHHKFVAAVNQL-GIDKAVPEKILGLMNVENITREDVASHLRKYRL 196 678****************.********************************8 PP | |||||||
2 | Response_reg | 66.9 | 9.5e-23 | 14 | 123 | 1 | 109 |
EEEESSSHHHHHHHHHHHHHTTCEEEEEESSHHHHHHHHHHHH..ESEEEEESSCTTSEHHHHHHHHHHHTTTSEEEEEESTTTHHHHHHHHHT CS Response_reg 1 vlivdDeplvrellrqalekegyeevaeaddgeealellkekd..pDlillDiempgmdGlellkeireeepklpiivvtahgeeedalealka 92 vl vd + + ++ l++ l++ +y +v+++++++ al++l+e++ +Dl++ D+ +p+mdGl+ll+ + e + + +++++ ++++e++ +a+ Medtr3g102590.1 14 VLAVDGDSTHLSDLETRLRSCQY-HVTTTSQAKTALTMLRENKdkFDLVIADVHLPDMDGLKLLELVELETDLPVVVMLSESSDNELVMKAVFH 106 788999999**************.***************888888********************9988887777788889999********** PP TESEEEESS--HHHHHH CS Response_reg 93 GakdflsKpfdpeelvk 109 Ga+dfl+Kp+ +el + Medtr3g102590.1 107 GASDFLVKPVRLQELKT 123 *************9976 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:3.40.50.2300 | 1.5E-33 | 11 | 146 | No hit | No description |
SuperFamily | SSF52172 | 1.1E-28 | 11 | 143 | IPR011006 | CheY-like superfamily |
SMART | SM00448 | 3.2E-22 | 12 | 125 | IPR001789 | Signal transduction response regulator, receiver domain |
PROSITE profile | PS50110 | 33.287 | 13 | 129 | IPR001789 | Signal transduction response regulator, receiver domain |
Pfam | PF00072 | 5.7E-20 | 14 | 124 | IPR001789 | Signal transduction response regulator, receiver domain |
CDD | cd00156 | 9.75E-18 | 15 | 129 | No hit | No description |
SuperFamily | SSF46689 | 2.33E-14 | 141 | 196 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 1.1E-19 | 143 | 197 | IPR006447 | Myb domain, plants |
Gene3D | G3DSA:1.10.10.60 | 1.2E-22 | 147 | 196 | IPR009057 | Homeodomain-like |
Pfam | PF00249 | 6.8E-6 | 147 | 195 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0000160 | Biological Process | phosphorelay signal transduction system | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 241 aa Download sequence Send to blast |
MDDSSDRFPI GMRVLAVDGD STHLSDLETR LRSCQYHVTT TSQAKTALTM LRENKDKFDL 60 VIADVHLPDM DGLKLLELVE LETDLPVVVM LSESSDNELV MKAVFHGASD FLVKPVRLQE 120 LKTIWQHVIR KKKDNEDLSA QKKSQSVWSV ELHHKFVAAV NQLGIDKAVP EKILGLMNVE 180 NITREDVASH LRKYRLIDYV KKVSSVANQH ASSLVAASRS ADQDEDKDED KENGHDNEDP 240 * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1irz_A | 2e-19 | 139 | 204 | 1 | 64 | ARR10-B |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. | |||||
UniProt | Transcriptional activator that binds specific DNA sequence. Functions as a response regulator involved in His-to-Asp phosphorelay signal transduction system. Phosphorylation of the Asp residue in the receiver domain activates the ability of the protein to promote the transcription of target genes. May directly activate some type-A response regulators in response to cytokinins. {ECO:0000250|UniProtKB:Q940D0}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr3g102590.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ647414 | 8e-43 | JQ647414.1 Medicago truncatula cultivar Jemalong A17 response regulator 1 (RR1) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013461736.2 | 1e-150 | uncharacterized protein LOC25489924 | ||||
Swissprot | A2X1N2 | 4e-85 | ORR24_ORYSI; Two-component response regulator ORR24 | ||||
Swissprot | Q6H805 | 5e-85 | ORR24_ORYSJ; Two-component response regulator ORR24 | ||||
TrEMBL | G8A2C3 | 1e-174 | G8A2C3_MEDTR; Two-component response regulator | ||||
STRING | AES83962 | 1e-175 | (Medicago truncatula) | ||||
STRING | AES85611 | 1e-175 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF18475 | 3 | 5 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G25180.1 | 2e-85 | response regulator 12 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr3g102590.1 |
Entrez Gene | 25489924 |
Publications ? help Back to Top | |||
---|---|---|---|
|