![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr3g098810.1 | ||||||||
Common Name | MTR_3g098810 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NAC | ||||||||
Protein Properties | Length: 242aa MW: 27406 Da PI: 8.7082 | ||||||||
Description | NAC family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NAM | 149.5 | 1.7e-46 | 14 | 141 | 1 | 128 |
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevls 94 lppGf F+Ptdeelv +yLk k+ + +l++ ++i+e++++k++PwdLp ++ +e++ yfFs+++ ky++++r nr+t+sgyWkatg+dk+v + Medtr3g098810.1 14 LPPGFCFQPTDEELVFHYLKCKIFSYQLPA-SIIPEINVCKFDPWDLPGNC--GEQDKYFFSSKEAKYRNSNRMNRTTSSGYWKATGSDKKVSV 104 79****************************.89***************544..77899**********************************99 PP NAM 95 k...kgelvglkktLvfykgrapkgektdWvmheyrl 128 + ++ g++k+Lvfy+g++p+g++t+W+mheyrl Medtr3g098810.1 105 SsslSNGIAGIRKSLVFYQGKSPNGSRTHWIMHEYRL 141 86776667***************************98 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SuperFamily | SSF101941 | 1.06E-53 | 10 | 170 | IPR003441 | NAC domain |
PROSITE profile | PS51005 | 51.447 | 14 | 170 | IPR003441 | NAC domain |
Pfam | PF02365 | 3.6E-24 | 15 | 141 | IPR003441 | NAC domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 242 aa Download sequence Send to blast |
MEKLNFVKNG VSKLPPGFCF QPTDEELVFH YLKCKIFSYQ LPASIIPEIN VCKFDPWDLP 60 GNCGEQDKYF FSSKEAKYRN SNRMNRTTSS GYWKATGSDK KVSVSSSLSN GIAGIRKSLV 120 FYQGKSPNGS RTHWIMHEYR LVSLGTTACN QLQNYANEIG NWVLCRIFTK KRSNIENGYM 180 MKSNIVMNTN VEVAQPRFFD FMRVHNLASD PTTHFSISSS CSSSSEVSSS EERCSDIYTD 240 F* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
3swm_A | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swm_B | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swm_C | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swm_D | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swp_A | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swp_B | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swp_C | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
3swp_D | 6e-47 | 14 | 173 | 20 | 171 | NAC domain-containing protein 19 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Up-regulated during xylem vessel element differentiation. {ECO:0000269|PubMed:20388856}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in xylem and phloem cells in roots and inflorescence stems (PubMed:20388856). Highly expressed in senescent leaves. Expressed in roots, and abscission and dehiscence tissues, such as axils of bracts and abscission zones in cauline leaves and siliques (PubMed:21673078). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcriptional repressor that negatively regulates the expression of genes involved in xylem vessel formation. Represses the transcriptional activation activity of NAC030/VND7, which regulates protoxylem vessel differentiation by promoting immature xylem vessel-specific genes expression (PubMed:20388856). Transcriptional activator that regulates the COLD-REGULATED (COR15A and COR15B) and RESPONSIVE TO DEHYDRATION (LTI78/RD29A and LTI65/RD29B) genes by binding directly to their promoters. Mediates signaling crosstalk between salt stress response and leaf aging process (PubMed:21673078). May play a role in DNA replication of mungbean yellow mosaic virus (PubMed:24442717). {ECO:0000269|PubMed:20388856, ECO:0000269|PubMed:21673078, ECO:0000269|PubMed:24442717}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr3g098810.1 |
Regulation -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | INDUCTION: By abscisic acid (ABA) and salt stress. {ECO:0000269|PubMed:21673078}. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC146747 | 1e-152 | AC146747.7 Medicago truncatula clone mth2-14h5, complete sequence. | |||
GenBank | CU062659 | 1e-152 | CU062659.10 M.truncatula DNA sequence from clone MTH2-14C23 on chromosome 3, complete sequence. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003602768.1 | 0.0 | NAC domain-containing protein 83 | ||||
Swissprot | Q9FY93 | 2e-69 | NAC83_ARATH; NAC domain-containing protein 83 | ||||
TrEMBL | G7J3B8 | 0.0 | G7J3B8_MEDTR; NAC transcription factor-like protein | ||||
STRING | AES73019 | 0.0 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF704 | 34 | 139 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G13180.1 | 6e-67 | NAC domain containing protein 83 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr3g098810.1 |
Entrez Gene | 11429693 |
Publications ? help Back to Top | |||
---|---|---|---|
|