![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr2g035610.1 | ||||||||
Common Name | MTR_2g035610 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | M-type_MADS | ||||||||
Protein Properties | Length: 123aa MW: 14373.1 Da PI: 10.8028 | ||||||||
Description | M-type_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 44.4 | 2.1e-14 | 10 | 51 | 2 | 43 |
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TT CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsst 43 +i n+ ++ t+ kR+n +lKK ELS+LC++e++ i+ +++ Medtr2g035610.1 10 FIVNDAAQKATYKKRKNNLLKKVDELSTLCGIEACAIVQGPH 51 68899999******************************9985 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 14.423 | 1 | 47 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 1.1E-15 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
SuperFamily | SSF55455 | 7.98E-23 | 2 | 94 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-6 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 4.3E-14 | 10 | 51 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 1.5E-6 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 123 aa Download sequence Send to blast |
MTRKKVKLTF IVNDAAQKAT YKKRKNNLLK KVDELSTLCG IEACAIVQGP HEPQPHIWPS 60 SWGVHRVLSK FRTMPELEKN KKMMNQETFM RQRVLKAKEK VEKLRKGNRE QEMTMIMFQC 120 LN* |
Nucleic Localization Signal ? help Back to Top | |||
---|---|---|---|
No. | Start | End | Sequence |
1 | 2 | 24 | RKKVKLTFIVNDAAQKATYKKRK |
2 | 16 | 24 | QKATYKKRK |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in the central cell of the female gametophyte and in early endosperm. Also detected in ovaries, young siliques, roots, leaves, stems, young flowers and anthers. {ECO:0000269|PubMed:16798889}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Probable transcription factor. Controls central cell differentiation during female gametophyte development. Required for the expression of DEMETER and DD46, but not for the expression of FIS2 (PubMed:16798889). Probable transcription factor that may function in the maintenance of the proper function of the central cell in pollen tube attraction (Probable). {ECO:0000269|PubMed:16798889, ECO:0000305|PubMed:26462908}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr2g035610.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003594867.1 | 7e-87 | agamous-like MADS-box protein AGL80 | ||||
Swissprot | Q9FJK3 | 2e-43 | AGL80_ARATH; Agamous-like MADS-box protein AGL80 | ||||
TrEMBL | G7IND5 | 2e-85 | G7IND5_MEDTR; MADS-box transcription factor family protein | ||||
STRING | AES65118 | 3e-86 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF452 | 33 | 154 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G48670.1 | 7e-46 | AGAMOUS-like 80 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr2g035610.1 |
Entrez Gene | 11438696 |
Publications ? help Back to Top | |||
---|---|---|---|
|