PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr2g026710.1 | ||||||||
Common Name | MTR_2g026710, NF-YB13 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 167aa MW: 17995.2 Da PI: 5.8379 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 186.2 | 2.5e-58 | 16 | 111 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPianvsrimkk+lPanakisk+aketvqecvsefisf+t+easdkcq+ekrktingddllwa++tlGfedyveplk+yl+kyre+eg Medtr2g026710.1 16 REQDRFLPIANVSRIMKKALPANAKISKEAKETVQECVSEFISFITGEASDKCQKEKRKTINGDDLLWAMTTLGFEDYVEPLKIYLSKYREMEG 109 89******************************************************************************************** PP NF-YB 96 ek 97 ek Medtr2g026710.1 110 EK 111 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.9E-56 | 11 | 124 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 9.32E-43 | 18 | 127 | IPR009072 | Histone-fold |
Pfam | PF00808 | 3.2E-28 | 21 | 85 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 1.8E-21 | 49 | 67 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 52 | 68 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 1.8E-21 | 68 | 86 | No hit | No description |
PRINTS | PR00615 | 1.8E-21 | 87 | 105 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 167 aa Download sequence Send to blast |
MAESDNESGG GQTGCREQDR FLPIANVSRI MKKALPANAK ISKEAKETVQ ECVSEFISFI 60 TGEASDKCQK EKRKTINGDD LLWAMTTLGF EDYVEPLKIY LSKYREMEGE KSAMIGRSDQ 120 RDGNVGEGSG GVYGHGVGVP SSMMMMMGHN MYGSGSGSPS SGRSTR* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 5e-50 | 16 | 106 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 5e-50 | 16 | 106 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Ubiquitous. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr2g026710.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | JQ918286 | 0.0 | JQ918286.1 Medicago truncatula nuclear transcription factor Y subunit B13 (NF-YB13) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_013462945.1 | 1e-120 | nuclear transcription factor Y subunit B-3 | ||||
Swissprot | O23310 | 2e-70 | NFYB3_ARATH; Nuclear transcription factor Y subunit B-3 | ||||
TrEMBL | I3TAX1 | 1e-119 | I3TAX1_MEDTR; Nuclear transcription factor Y protein | ||||
STRING | XP_004486346.1 | 1e-93 | (Cicer arietinum) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF591 | 34 | 150 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT4G14540.1 | 1e-72 | nuclear factor Y, subunit B3 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr2g026710.1 |
Entrez Gene | 25486265 |
Publications ? help Back to Top | |||
---|---|---|---|
|