PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g072790.1 | ||||||||
Common Name | MTR_1g072790 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 177aa MW: 19488.6 Da PI: 5.6453 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 184.4 | 8.9e-58 | 28 | 123 | 2 | 97 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyreleg 95 reqdrflPian+srimkk+lP+n+ki+kdak+t+qecvsefisf+tseas+kcq+ekrktingddllwa+atlGfedy+eplkvyl++yreleg Medtr1g072790.1 28 REQDRFLPIANISRIMKKALPSNGKIAKDAKDTMQECVSEFISFITSEASEKCQKEKRKTINGDDLLWAMATLGFEDYIEPLKVYLARYRELEG 121 89******************************************************************************************** PP NF-YB 96 ek 97 ++ Medtr1g072790.1 122 DS 123 97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 1.4E-54 | 24 | 135 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 1.04E-41 | 30 | 136 | IPR009072 | Histone-fold |
Pfam | PF00808 | 1.2E-29 | 33 | 97 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 2.3E-21 | 61 | 79 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 64 | 80 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 2.3E-21 | 80 | 98 | No hit | No description |
PRINTS | PR00615 | 2.3E-21 | 99 | 117 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 177 aa Download sequence Send to blast |
MADAPNQCEE SHESGGEQSP RGSSSASREQ DRFLPIANIS RIMKKALPSN GKIAKDAKDT 60 MQECVSEFIS FITSEASEKC QKEKRKTING DDLLWAMATL GFEDYIEPLK VYLARYRELE 120 GDSKGSVRNS DGSGRRDQVG GPPGQNAQFV HQGSLSYIDS QVHPQHLVMP SMQNHE* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
4g91_B | 3e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
4g92_B | 3e-48 | 28 | 118 | 2 | 92 | Transcription factor HapC (Eurofung) |
Search in ModeBase |
Expression -- UniGene ? help Back to Top | ||||||
---|---|---|---|---|---|---|
UniGene ID | E-value | Expressed in | ||||
Mtr.14376 | 0.0 | flower| root |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in flowers and mature rosettes. {ECO:0000269|PubMed:11250072}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g072790.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | BT051316 | 0.0 | BT051316.1 Medicago truncatula clone MTYF1_F2_F3_F41G-K-6 unknown mRNA. | |||
GenBank | BT138320 | 0.0 | BT138320.1 Medicago truncatula clone JCVI-FLMt-10C19 unknown mRNA. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003590706.2 | 1e-130 | nuclear transcription factor Y subunit B-1 | ||||
Refseq | XP_024636101.1 | 1e-130 | nuclear transcription factor Y subunit B-1 | ||||
Swissprot | Q8VYK4 | 2e-75 | NFYB8_ARATH; Nuclear transcription factor Y subunit B-8 | ||||
TrEMBL | B7FGV1 | 1e-129 | B7FGV1_MEDTR; Nuclear transcription factor Y subunit B | ||||
STRING | AES60957 | 1e-126 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2545 | 33 | 82 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G37060.3 | 9e-78 | nuclear factor Y, subunit B8 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g072790.1 |
Entrez Gene | 11429747 |
Publications ? help Back to Top | |||
---|---|---|---|
|