PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g039040.1 | ||||||||
Common Name | MTR_1g039040, NF-YB10 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 191aa MW: 21648 Da PI: 5.8644 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 170 | 2.8e-53 | 5 | 99 | 2 | 96 |
NF-YB 2 reqdrflPianvsrimkkvlPanakiskdaketvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 reqd+++Pianv+rim+++lP++akis+daket+qecvse+isf+tsea+d+cqre+rkt++++d+lwa+++lGf+dyv+pl+ yl++yre ege Medtr1g039040.1 5 REQDQYMPIANVIRIMRRILPSHAKISDDAKETIQECVSEYISFITSEANDRCQREQRKTVTAEDILWAMGKLGFDDYVHPLTFYLQRYRESEGE 99 89******************************************************************************************997 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:1.10.20.10 | 4.8E-48 | 3 | 105 | IPR009072 | Histone-fold |
SuperFamily | SSF47113 | 5.28E-37 | 7 | 106 | IPR009072 | Histone-fold |
Pfam | PF00808 | 5.0E-26 | 10 | 74 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
PRINTS | PR00615 | 8.1E-16 | 38 | 56 | No hit | No description |
PROSITE pattern | PS00685 | 0 | 41 | 57 | IPR003956 | Transcription factor, NFYB/HAP3, conserved site |
PRINTS | PR00615 | 8.1E-16 | 57 | 75 | No hit | No description |
PRINTS | PR00615 | 8.1E-16 | 76 | 94 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 191 aa Download sequence Send to blast |
MAGIREQDQY MPIANVIRIM RRILPSHAKI SDDAKETIQE CVSEYISFIT SEANDRCQRE 60 QRKTVTAEDI LWAMGKLGFD DYVHPLTFYL QRYRESEGEP ASVRRTSSLA LPPSFPLMQQ 120 HSSSFSSMPL PLINNNNHNS NGYGHGYGFD FDQGFYRDGG DDAAPSSASF VPNFDCNFLH 180 LKRDNHNNNM * |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 2e-56 | 4 | 95 | 6 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g039040.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AC151709 | 0.0 | AC151709.9 Medicago truncatula clone mth2-31g22, complete sequence. | |||
GenBank | JQ918283 | 0.0 | JQ918283.1 Medicago truncatula nuclear trancription factor Y subunit B10 (NF-YB10) mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003589766.1 | 1e-143 | nuclear transcription factor Y subunit B-4 | ||||
Swissprot | Q84W66 | 3e-57 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | G7ICG4 | 1e-141 | G7ICG4_MEDTR; Ccaat-box-binding factor HAP3-like protein | ||||
STRING | AES60017 | 1e-142 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2728 | 32 | 79 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 2e-59 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g039040.1 |
Entrez Gene | 11429280 |