PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g038300.1 | ||||||||
Common Name | MTR_1g038300 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | MIKC_MADS | ||||||||
Protein Properties | Length: 233aa MW: 27417.4 Da PI: 6.9645 | ||||||||
Description | MIKC_MADS family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | SRF-TF | 80.6 | 1.1e-25 | 9 | 59 | 1 | 51 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 k+i+nk+ rqvtfskRr+g+lKK +ELSvLC+a++ +iifsstgkl y+s Medtr1g038300.1 9 KKIQNKTTRQVTFSKRRTGLLKKTHELSVLCEAQIGLIIFSSTGKLSQYCS 59 68***********************************************96 PP | |||||||
2 | K-box | 57.4 | 6.2e-20 | 94 | 174 | 16 | 96 |
K-box 16 slqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelqkkekelqeenkaLrk 96 ++ +++a L++e L+ + ++lG+d+++L++ +L ++e++Le sl k+R+++nel+ +q+e+lq+ke+ lq+en++L++ Medtr1g038300.1 94 EMFHDMAMLRQESLRLELGIQRYLGDDMKDLQFDDLSKIEHELEISLAKVRNRQNELMQQQMENLQRKERILQDENMNLSN 174 56788999**********************************************************************975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50066 | 30.109 | 1 | 61 | IPR002100 | Transcription factor, MADS-box |
SMART | SM00432 | 3.6E-38 | 1 | 60 | IPR002100 | Transcription factor, MADS-box |
CDD | cd00265 | 9.65E-41 | 2 | 78 | No hit | No description |
SuperFamily | SSF55455 | 2.49E-31 | 2 | 86 | IPR002100 | Transcription factor, MADS-box |
PROSITE pattern | PS00350 | 0 | 3 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-27 | 3 | 23 | IPR002100 | Transcription factor, MADS-box |
Pfam | PF00319 | 2.9E-22 | 10 | 57 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-27 | 23 | 38 | IPR002100 | Transcription factor, MADS-box |
PRINTS | PR00404 | 2.7E-27 | 38 | 59 | IPR002100 | Transcription factor, MADS-box |
PROSITE profile | PS51297 | 13.403 | 92 | 183 | IPR002487 | Transcription factor, K-box |
Pfam | PF01486 | 2.2E-17 | 93 | 174 | IPR002487 | Transcription factor, K-box |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0008360 | Biological Process | regulation of cell shape | ||||
GO:0019252 | Biological Process | starch biosynthetic process | ||||
GO:0043068 | Biological Process | positive regulation of programmed cell death | ||||
GO:0048316 | Biological Process | seed development | ||||
GO:0048481 | Biological Process | plant ovule development | ||||
GO:0080155 | Biological Process | regulation of double fertilization forming a zygote and endosperm | ||||
GO:2000029 | Biological Process | regulation of proanthocyanidin biosynthetic process | ||||
GO:0005634 | Cellular Component | nucleus | ||||
GO:0003677 | Molecular Function | DNA binding | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0046983 | Molecular Function | protein dimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 233 aa Download sequence Send to blast |
MGRGKIEIKK IQNKTTRQVT FSKRRTGLLK KTHELSVLCE AQIGLIIFSS TGKLSQYCSD 60 STRMDQIIER YERSTGKRIM AEHDDHQIHP RELEMFHDMA MLRQESLRLE LGIQRYLGDD 120 MKDLQFDDLS KIEHELEISL AKVRNRQNEL MQQQMENLQR KERILQDENM NLSNWEHKAV 180 MENKAVMDQF AFFEDQPLSR ILQLAAPVNP YLQLGQPVFQ DYNLKTRDLD HP* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5f28_A | 2e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_B | 2e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_C | 2e-19 | 1 | 71 | 1 | 69 | MEF2C |
5f28_D | 2e-19 | 1 | 71 | 1 | 69 | MEF2C |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed during seed development. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in buds, flowers and immature seeds, but not in roots, stems, leaves, seedlings or siliques valves. Expression in seed coat is confined to the endothelium layer. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor involved in the developmental regulation of the endothelium and in the accumulation of proanthocyanidins (PAs) or condensed tannins which give the seed its brown pigmentation after oxidation (PubMed:12368498, PubMed:16080001). Necessary for the normal activation of the BANYULS promoter in the endothelium body (PubMed:12368498). Is required, together with AGL11/STK for the maternal control of endothelium formation, which is essential for female gametophyte development and fertilization, and seed formation (PubMed:22176531). Interacts genetically with AGL1/SHP1 and AGL5/SHP2 in a partially antagonistic manner and represses AGL1/SHP1, AGL5/SHP2, and AGL8/FUL during flower development. Is essential for the coordination of cell divisions in ovule, seed coat development and endosperm formation (PubMed:27776173). Mediates the crosstalk between endothelium and nucellus to ensure proper seed formation. Functions redundantly with AGL63/GOA to repress nucellus growth and promote its degeneration. Represses the negative regulator of autophagy and programmed cell death HVA22D in the proximal nucellus (PubMed:27233529). Binds specifically to the CArG box DNA sequence 5'-CC (A/T)6 GG-3' (PubMed:16080001). {ECO:0000269|PubMed:12368498, ECO:0000269|PubMed:16080001, ECO:0000269|PubMed:22176531, ECO:0000269|PubMed:27233529, ECO:0000269|PubMed:27776173}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g038300.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_003589705.1 | 1e-173 | protein TRANSPARENT TESTA 16 | ||||
Refseq | XP_024631757.1 | 1e-173 | protein TRANSPARENT TESTA 16 | ||||
Refseq | XP_024631759.1 | 1e-173 | protein TRANSPARENT TESTA 16 | ||||
Refseq | XP_024631761.1 | 1e-173 | protein TRANSPARENT TESTA 16 | ||||
Refseq | XP_024631764.1 | 1e-173 | protein TRANSPARENT TESTA 16 | ||||
Swissprot | Q8RYD9 | 3e-63 | TT16_ARATH; Protein TRANSPARENT TESTA 16 | ||||
TrEMBL | G7IA45 | 1e-171 | G7IA45_MEDTR; MADS-box transcription factor | ||||
STRING | AES59956 | 1e-172 | (Medicago truncatula) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF4935 | 29 | 52 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G23260.2 | 1e-65 | MIKC_MADS family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g038300.1 |
Entrez Gene | 11433884 |