PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Medtr1g028480.1 | ||||||||
Common Name | MTR_1g028480 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Fabales; Fabaceae; Papilionoideae; Trifolieae; Medicago
|
||||||||
Family | NF-YB | ||||||||
Protein Properties | Length: 112aa MW: 12440.7 Da PI: 4.3943 | ||||||||
Description | NF-YB family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | NF-YB | 80.5 | 2.3e-25 | 19 | 82 | 33 | 96 |
NF-YB 33 etvqecvsefisfvtseasdkcqrekrktingddllwalatlGfedyveplkvylkkyrelege 96 e+ + c sef s +tseas++c+ e+rk i+++dl+wa+ lGf+dyv pl yl++yr+ e++ Medtr1g028480.1 19 ESQNTCLSEFTSSITSEASERCKIEHRKIITANDLIWAMDRLGFDDYVGPLVFYLQRYRNYEAQ 82 66788*******************************************************9975 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PRINTS | PR00615 | 2.8E-7 | 21 | 39 | No hit | No description |
Pfam | PF00808 | 2.4E-8 | 22 | 57 | IPR003958 | Transcription factor CBF/NF-Y/archaeal histone domain |
SuperFamily | SSF47113 | 7.86E-19 | 22 | 87 | IPR009072 | Histone-fold |
Gene3D | G3DSA:1.10.20.10 | 5.0E-21 | 23 | 84 | IPR009072 | Histone-fold |
PRINTS | PR00615 | 2.8E-7 | 40 | 58 | No hit | No description |
PRINTS | PR00615 | 2.8E-7 | 59 | 77 | No hit | No description |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0046982 | Molecular Function | protein heterodimerization activity |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 112 aa Download sequence Send to blast |
MICLDGVHFE EGNSSTNIES QNTCLSEFTS SITSEASERC KIEHRKIITA NDLIWAMDRL 60 GFDDYVGPLV FYLQRYRNYE AQCNDVPIKF GFDKDGSSAR GSNNGSDNVQ G* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5g49_A | 1e-20 | 19 | 78 | 38 | 97 | NUCLEAR TRANSCRIPTION FACTOR Y SUBUNIT B-6 |
Search in ModeBase |
Expression -- Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
Uniprot | DEVELOPMENTAL STAGE: Expressed primarily during seed development. {ECO:0000269|PubMed:12509518}. | |||||
Uniprot | TISSUE SPECIFICITY: Expressed in roots, flowers and developing siliques. Present in etiolated seedlings. {ECO:0000269|PubMed:11250072, ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Component of the NF-Y/HAP transcription factor complex. The NF-Y complex stimulates the transcription of various genes by recognizing and binding to a CCAAT motif in promoters. Plays a role in the regulation of the embryogenesis. Involved in the abscisic acid (ABA) signaling pathway. {ECO:0000269|PubMed:12509518, ECO:0000269|PubMed:17322342}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Medtr1g028480.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_004498386.1 | 3e-32 | nuclear transcription factor Y subunit B-3-like | ||||
Swissprot | Q84W66 | 3e-20 | NFYB6_ARATH; Nuclear transcription factor Y subunit B-6 | ||||
TrEMBL | A0A072VG79 | 9e-78 | A0A072VG79_MEDTR; Nuclear transcription factor Y protein | ||||
STRING | XP_004498386.1 | 1e-31 | (Cicer arietinum) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G47670.2 | 7e-23 | nuclear factor Y, subunit B6 |
Link Out ? help Back to Top | |
---|---|
Phytozome | Medtr1g028480.1 |
Entrez Gene | 25482368 |