PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot

Family

MYB_related

Protein Properties

Length: 91aa MW: 10533 Da PI: 10.1068

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Manes.17G034300.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	47.8	3.4e-15	13	60	1	48
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48 +g W++eEd +l+ +++++G +W+ ++ g+ R++k+c++rw +yl Manes.17G034300.1.p 13 KGTWSPEEDHKLIAYINRYGIWNWTQMPKAAGLSRSGKSCRLRWINYL 60 799***************99**********************97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
Gene3D	G3DSA:1.10.10.60	5.4E-22	5	63	IPR009057	Homeodomain-like
PROSITE profile	PS51294	18.866	8	64	IPR017930	Myb domain
SMART	SM00717	1.2E-10	12	62	IPR001005	SANT/Myb domain
Pfam	PF00249	9.0E-14	13	60	IPR001005	SANT/Myb domain
SuperFamily	SSF46689	1.74E-21	14	88	IPR009057	Homeodomain-like
CDD	cd00167	1.83E-8	15	60	No hit	No description
PROSITE profile	PS50090	3.926	61	90	IPR017877	Myb-like domain
Gene3D	G3DSA:1.10.10.60	8.1E-8	64	89	IPR009057	Homeodomain-like

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 91 aa Download sequence Send to blast
MRAPNSDQIP LKKGTWSPEE DHKLIAYINR YGIWNWTQMP KAAGLSRSGK SCRLRWINYL 60 RSNIRHGNFT KQEEETIINL HEMLGNGYSN *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1a5j_A	2e-13	9	89	2	82	B-MYB
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional activator involved in cold stress response (PubMed:14675437, PubMed:20807373, PubMed:22246661). Regulates positively the expression of genes involved in reactive oxygen species (ROS) scavenging such as peroxidase and superoxide dismutase during cold stress. Transactivates a complex gene network that have major effects on stress tolerance and panicle development (PubMed:20807373). {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|PubMed:22246661}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Manes.17G034300.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By cold stress. {ECO:0000269\|PubMed:14675437, ECO:0000269\|PubMed:20807373, ECO:0000269\|Ref.2}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021683025.1	9e-54	transcription factor MYB13-like
Swissprot	Q7XBH4	1e-34	MYB4_ORYSJ; Transcription factor MYB4
TrEMBL	A0A2C9U4T0	5e-61	A0A2C9U4T0_MANES; Uncharacterized protein
STRING	cassava4.1_025565m	4e-60	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF31	34	817

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT2G31180.1	8e-36	myb domain protein 14

Link Out ? help Back to Top
Phytozome	Manes.17G034300.1.p

Publications ? help Back to Top
Park MR, et al. Supra-optimal expression of the cold-regulated OsMyb4 transcription factor in transgenic rice changes the complexity of transcriptional network with major effects on stress tolerance and panicle development. Plant Cell Environ., 2010. 33(12): p. 2209-30 [PMID:20807373] Soltész A, et al. The rice Osmyb4 gene enhances tolerance to frost and improves germination under unfavourable conditions in transgenic barley plants. J. Appl. Genet., 2012. 53(2): p. 133-43 [PMID:22246661]