PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | Manes.16G007100.1.p | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot
|
||||||||
Family | MYB_related | ||||||||
Protein Properties | Length: 82aa MW: 9179.95 Da PI: 4.2822 | ||||||||
Description | MYB_related family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | Myb_DNA-binding | 33.5 | 9.6e-11 | 30 | 71 | 1 | 44 |
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHH CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrw 44 r ++++E+ l+++ + + G + W++Ia +++ gRt++++ +w Manes.16G007100.1.p 30 RPEFSEDEESLIARMFSLVGER-WSLIAGRIP-GRTAEEIEKYW 71 6789******************.*********.*********** PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 9.173 | 25 | 79 | IPR017930 | Myb domain |
SMART | SM00717 | 2.3E-8 | 29 | 77 | IPR001005 | SANT/Myb domain |
Pfam | PF00249 | 8.4E-10 | 30 | 72 | IPR001005 | SANT/Myb domain |
SuperFamily | SSF46689 | 4.68E-9 | 30 | 75 | IPR009057 | Homeodomain-like |
CDD | cd00167 | 9.53E-8 | 32 | 71 | No hit | No description |
Gene3D | G3DSA:1.10.10.60 | 1.6E-12 | 33 | 73 | IPR009057 | Homeodomain-like |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 82 aa Download sequence Send to blast |
MSMADSVDYT SNETTSTQDS KEGVKSQDSR PEFSEDEESL IARMFSLVGE RWSLIAGRIP 60 GRTAEEIEKY WTSKYSSSSE R* |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | MYB-type transcription factor involved in epidermal cell fate specification. Acts as a negative regulator of trichome development, by mediating lateral inhibition. Promotes the formation of hair developing cells in H position in root epidermis, probably by inhibiting non-hair cell formation. {ECO:0000269|PubMed:15063185, ECO:0000269|PubMed:15584952}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | Manes.16G007100.1.p |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_021597895.1 | 6e-52 | MYB-like transcription factor ETC1 isoform X1 | ||||
Swissprot | Q9LNI5 | 3e-17 | ETC1_ARATH; MYB-like transcription factor ETC1 | ||||
TrEMBL | A0A2C9U7L3 | 1e-50 | A0A2C9U7L3_MANES; Uncharacterized protein | ||||
STRING | cassava4.1_026343m | 2e-51 | (Manihot esculenta) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF2692 | 31 | 78 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT1G01380.1 | 1e-19 | MYB_related family protein |
Link Out ? help Back to Top | |
---|---|
Phytozome | Manes.16G007100.1.p |