PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot

Family

M-type_MADS

Protein Properties

Length: 101aa MW: 11243.2 Da PI: 10.8371

Description

M-type_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Manes.12G122200.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	83.7	1.1e-26	10	59	2	51
---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 2 rienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 ri+n++ rqvtfskRr+g++KKA+EL +LCdaev + ifss+gklye++s Manes.12G122200.1.p 10 RIDNSTSRQVTFSKRRKGLIKKAKELAILCDAEVGLAIFSSSGKLYEFAS 59 8***********************************************86 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SMART	SM00432	4.8E-37	1	60	IPR002100	Transcription factor, MADS-box
PROSITE profile	PS50066	30.796	1	61	IPR002100	Transcription factor, MADS-box
SuperFamily	SSF55455	5.76E-28	2	72	IPR002100	Transcription factor, MADS-box
CDD	cd00265	4.71E-36	2	60	No hit	No description
PRINTS	PR00404	4.4E-28	3	23	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	1.2E-24	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-28	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	4.4E-28	38	59	IPR002100	Transcription factor, MADS-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0003677	Molecular Function	DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 101 aa Download sequence Send to blast
MGRGKIVIRR IDNSTSRQVT FSKRRKGLIK KAKELAILCD AEVGLAIFSS SGKLYEFAST 60 RLDMFFSTTT SIVSLLLLQN YNHQFLLSAL IVSWEKLASL *

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
6bz1_A	5e-20	1	63	1	63	MEF2 CHIMERA
6bz1_B	5e-20	1	63	1	63	MEF2 CHIMERA
6bz1_C	5e-20	1	63	1	63	MEF2 CHIMERA
6bz1_D	5e-20	1	63	1	63	MEF2 CHIMERA
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcriptional factor that targets the CArG motif 5'-C(A/T)TTAAAAAG-3' in the promoter of D14. Directly suppresses D14 expression to control the outgrowth of axillary buds. {ECO:0000269\|PubMed:23463009}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Manes.12G122200.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_015890524.1	2e-35	MADS-box transcription factor 23
Refseq	XP_022741403.1	1e-35	agamous-like MADS-box protein AGL21
Swissprot	Q6Z6W2	3e-32	MAD57_ORYSJ; MADS-box transcription factor 57
TrEMBL	A0A2C9UVZ9	5e-65	A0A2C9UVZ9_MANES; Uncharacterized protein
STRING	cassava4.1_022451m	2e-35	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF119	33	360

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT4G37940.1	2e-34	AGAMOUS-like 21

Link Out ? help Back to Top
Phytozome	Manes.12G122200.1.p

Publications ? help Back to Top
Guo S, et al. The interaction between OsMADS57 and OsTB1 modulates rice tillering via DWARF14. Nat Commun, 2013. 4: p. 1566 [PMID:23463009] Puig J, et al. Analysis of the expression of the AGL17-like clade of MADS-box transcription factors in rice. Gene Expr. Patterns, 2013 Jun-Jul. 13(5-6): p. 160-70 [PMID:23466806] Yu C, et al. The effects of fluctuations in the nutrient supply on the expression of five members of the AGL17 clade of MADS-box genes in rice. PLoS ONE, 2014. 9(8): p. e105597 [PMID:25140876] Wang H, et al. A Signaling Cascade from miR444 to RDR1 in Rice Antiviral RNA Silencing Pathway. Plant Physiol., 2016. 170(4): p. 2365-77 [PMID:26858364]