PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Manes.07G042400.1.p

Organism

Manihot esculenta

Taxonomic ID

3983

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot

Family

NAC

Protein Properties

Length: 174aa MW: 20210.6 Da PI: 9.8472

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Manes.07G042400.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	136	2.5e-42	29	158	1	128
NAM 1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpk..kvka.eekewyfFskrdkkyatgkrknr.atksgyWkat 86 lp G+rF P+d+el+ +y +k+++++l+ + i+ vd+y++ P++L + k++ +e++wyfF++r+kky++g+r++r a + gyWkat Manes.07G042400.1.p 29 LPIGYRFAPSDDELIRYYVLRKISNEPLPP-NRIHVVDLYNYSPQQLAEtyKLNReRESQWYFFTSREKKYPNGSRPKRnAGELGYWKAT 117 699**********************999.77**********842333332556****************77889** PP NAM 87 gkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 g+dk++l+ +++ g +k+L +y+gr+++g+kt+W mhey l Manes.07G042400.1.p 118 GTDKAILD-GKKPLGFRKSLDYYEGRQRDGTKTNWKMHEYLL 158 ****.999**************************76 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
SuperFamily	SSF101941	4.58E-47	24	161	IPR003441	NAC domain
PROSITE profile	PS51005	44.101	29	173	IPR003441	NAC domain
Pfam	PF02365	5.1E-22	30	157	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 174 aa Download sequence Send to blast
MEQNQNKNKG VAADCNTSSD DVERYFNSLP IGYRFAPSDD ELIRYYVLRK ISNEPLPPNR 60 IHVVDLYNYS PQQLAETYKL NRERESQWYF FTSREKKYPN GSRPKRNAGE LGYWKATGTD 120 KAILDGKKPL GFRKSLDYYE GRQRDGTKTN WKMHEYLLHR SLVPSGATAR GMQ*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
3ulx_A	2e-36	21	158	8	140	Stress-induced transcription factor NAC1
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription activator that binds to, and transactivates the promoter of the abscisic aldehyde oxidase AAO3. Promotes chlorophyll degradation in leaves by enhancing transcription of AAO3, which leads to increased levels of the senescence-inducing hormone abscisic acid (ABA) (PubMed:25516602). Involved in the control of dehydration in senescing leaves. Binds to the DNA sequence 5'-CACGTAAGT-3' of SAG113 promoter. SAG113 acts as negative regulator of ABA signaling for stomatal closure in leaves, and controls water loss during leaf senescence (PubMed:22184656). Transcription factor of the NAC family involved in senescence. May function in the transition between active cell division and cell expansion (PubMed:16640597). Required for normal seed development and morphology (PubMed:18849494). {ECO:0000269\|PubMed:16640597, ECO:0000269\|PubMed:18849494, ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:25516602}.

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Manes.07G042400.1.p

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: Induced by the heterodimer APETALA3 (AP3)/PISTILLATA (PI) (PubMed:9489703). Induced by senescence (PubMed:22184656, PubMed:24659488, PubMed:25516602). Induced by abscisic acid (ABA) (PubMed:22184656, PubMed:25516602). Induced by ethylene (PubMed:25516602). {ECO:0000269\|PubMed:22184656, ECO:0000269\|PubMed:24659488, ECO:0000269\|PubMed:25516602, ECO:0000269\|PubMed:9489703}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021618221.1	1e-128	NAC transcription factor 29-like
Swissprot	O49255	2e-39	NAC29_ARATH; NAC transcription factor 29
TrEMBL	A0A2C9VIE3	1e-127	A0A2C9VIE3_MANES; Uncharacterized protein
STRING	EOY09270	8e-48	(Theobroma cacao)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF4103	32	62

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G69490.1	9e-42	NAC-like, activated by AP3/PI

Link Out ? help Back to Top
Phytozome	Manes.07G042400.1.p

Publications ? help Back to Top
Zhang K,Gan SS An abscisic acid-AtNAP transcription factor-SAG113 protein phosphatase 2C regulatory chain for controlling dehydration in senescing Arabidopsis leaves. Plant Physiol., 2012. 158(2): p. 961-9 [PMID:22184656] Zhang K,Halitschke R,Yin C,Liu CJ,Gan SS Salicylic acid 3-hydroxylase regulates Arabidopsis leaf longevity by mediating salicylic acid catabolism. Proc. Natl. Acad. Sci. U.S.A., 2013. 110(36): p. 14807-12 [PMID:23959884] Shinozaki Y, et al. Expression of an AtNAP gene homolog in senescing morning glory (Ipomoea nil) petals of two cultivars with a different flower life span. J. Plant Physiol., 2014. 171(8): p. 633-8 [PMID:24709156] Xiao D, et al. SENESCENCE-SUPPRESSED PROTEIN PHOSPHATASE Directly Interacts with the Cytoplasmic Domain of SENESCENCE-ASSOCIATED RECEPTOR-LIKE KINASE and Negatively Regulates Leaf Senescence in Arabidopsis. Plant Physiol., 2015. 169(2): p. 1275-91 [PMID:26304848] Sakuraba Y,Han SH,Lee SH,Hörtensteiner S,Paek NC Arabidopsis NAC016 promotes chlorophyll breakdown by directly upregulating STAYGREEN1 transcription. Plant Cell Rep., 2016. 35(1): p. 155-66 [PMID:26441053] Seok HY, et al. Arabidopsis AtNAP functions as a negative regulator via repression of AREB1 in salt stress response. Planta, 2017. 245(2): p. 329-341 [PMID:27770200]