PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

PlantRegMap/PlantTFDB v5.0

Plant Transcription Factor Database

Transcription Factor Information

Basic Information | Signature Domain | Sequence |

Basic Information? help Back to Top

TF ID

Manes.02G166000.1.p

Organism

Manihot esculenta

Taxonomic ID

3983

Taxonomic Lineage

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Malpighiales; Euphorbiaceae; Crotonoideae; Manihoteae; Manihot

Family

NAC

Protein Properties

Length: 234aa MW: 26493.8 Da PI: 8.9514

Description

NAC family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
Manes.02G166000.1.p	genome	JGI	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	NAM	97	2.9e-30	5	77	54	128
NAM 54 eekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkgelvglkktLvfykgrapkgektdWvmheyrl 128 +ekewyfFs+rd+ky++g+r+nra+ +gyWkatg dk++ + + g+kk Lvfy g+apkgekt+W+mheyrl Manes.02G166000.1.p 5 GEKEWYFFSPRDRKYPNGSRPNRAAGTGYWKATGADKPIGQ--PKPLGIKKALVFYAGKAPKGEKTNWIMHEYRL 77 579**********************************98..789*************************98 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51005	41.058	1	103	IPR003441	NAC domain
SuperFamily	SSF101941	1.83E-36	3	103	IPR003441	NAC domain
Pfam	PF02365	1.1E-14	9	77	IPR003441	NAC domain

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 234 aa Download sequence Send to blast
MALYGEKEWY FFSPRDRKYP NGSRPNRAAG TGYWKATGAD KPIGQPKPLG IKKALVFYAG 60 KAPKGEKTNW IMHEYRLADV DRSARKKNSS RLDDWVLCRI YNKKGTIDKH GQPINRKLSS 120 PEIIEDKKPE IMAPPPAPSS ATGTVNDYAY FDTSDSVPKL HTDSSCSDHV VSPEFTCEVQ 180 SEPKWKEWGN VNALDFSYNY TDATMENPFA SQFQGNNQMS PLQDMFMYLQ KPF*

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
1ut4_A	6e-49	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut4_B	6e-49	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut7_A	6e-49	2	109	66	171	NO APICAL MERISTEM PROTEIN
1ut7_B	6e-49	2	109	66	171	NO APICAL MERISTEM PROTEIN
3swm_A	6e-49	2	109	69	174	NAC domain-containing protein 19
3swm_B	6e-49	2	109	69	174	NAC domain-containing protein 19
3swm_C	6e-49	2	109	69	174	NAC domain-containing protein 19
3swm_D	6e-49	2	109	69	174	NAC domain-containing protein 19
3swp_A	6e-49	2	109	69	174	NAC domain-containing protein 19
3swp_B	6e-49	2	109	69	174	NAC domain-containing protein 19
3swp_C	6e-49	2	109	69	174	NAC domain-containing protein 19
3swp_D	6e-49	2	109	69	174	NAC domain-containing protein 19
4dul_A	6e-49	2	109	66	171	NAC domain-containing protein 19
4dul_B	6e-49	2	109	66	171	NAC domain-containing protein 19
Search in ModeBase

Cis-element ? help Back to Top
Source	Link
PlantRegMap	Manes.02G166000.1.p

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	-

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	KR605168	0.0	KR605168.1 Manihot esculenta NAC transcription factors 30 mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_021604672.1	1e-175	NAC domain-containing protein 2-like
Swissprot	Q39013	1e-113	NAC2_ARATH; NAC domain-containing protein 2
TrEMBL	A0A2C9WG19	1e-175	A0A2C9WG19_MANES; Uncharacterized protein
STRING	cassava4.1_013132m	1e-175	(Manihot esculenta)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Fabids	OGEF1258	34	108

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G01720.1	1e-113	NAC family protein

Link Out ? help Back to Top
Phytozome	Manes.02G166000.1.p

Publications ? help Back to Top
Florentin A,Damri M,Grafi G Stress induces plant somatic cells to acquire some features of stem cells accompanied by selective chromatin reorganization. Dev. Dyn., 2013. 242(10): p. 1121-33 [PMID:23798027] Jensen MK, et al. ATAF1 transcription factor directly regulates abscisic acid biosynthetic gene NCED3 in Arabidopsis thaliana. FEBS Open Bio, 2013. 3: p. 321-7 [PMID:23951554] Wang YX Characterization of a novel Medicago sativa NAC transcription factor gene involved in response to drought stress. Mol. Biol. Rep., 2013. 40(11): p. 6451-8 [PMID:24057250] Yang X, et al. Overexpression of a Miscanthus lutarioriparius NAC gene MlNAC5 confers enhanced drought and cold tolerance in Arabidopsis. Plant Cell Rep., 2015. 34(6): p. 943-58 [PMID:25666276] Hu W, et al. Genome-Wide Identification and Expression Analysis of the NAC Transcription Factor Family in Cassava. PLoS ONE, 2015. 10(8): p. e0136993 [PMID:26317631] Du Q,Wang H The role of HD-ZIP III transcription factors and miR165/166 in vascular development and secondary cell wall formation. Plant Signal Behav, 2015. 10(10): p. e1078955 [PMID:26340415] Takasaki H, et al. SNAC-As, stress-responsive NAC transcription factors, mediate ABA-inducible leaf senescence. Plant J., 2015. 84(6): p. 1114-23 [PMID:26518251] Liu Y,Sun J,Wu Y Arabidopsis ATAF1 enhances the tolerance to salt stress and ABA in transgenic rice. J. Plant Res., 2016. 129(5): p. 955-962 [PMID:27216423] Ghandchi FP,Caetano-Anolles G,Clough SJ,Ort DR Investigating the Control of Chlorophyll Degradation by Genomic Correlation Mining. PLoS ONE, 2016. 11(9): p. e0162327 [PMID:27618630] Zhao J,Missihoun TD,Bartels D The ATAF1 transcription factor is a key regulator of aldehyde dehydrogenase 7B4 (ALDH7B4) gene expression in Arabidopsis thaliana. Planta, 2018. 248(4): p. 1017-1027 [PMID:30027414]