PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

MYB_related

Protein Properties

Length: 62aa MW: 7115.92 Da PI: 6.4992

Description

MYB_related family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_78895.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	Myb_DNA-binding	42.2	1.8e-13	4	39	1	37
TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-H CS Myb_DNA-binding 1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtl 37 rg W + Ede+l+++v+++G+++W++Ia++++ gR++ MLOC_78895.2 4 RGHWRPSEDERLKELVARYGPHNWNAIAEKLQ-GRSG 39 899***************************.97 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS51294	13.529	1	56	IPR017930	Myb domain
SuperFamily	SSF46689	6.8E-10	3	39	IPR009057	Homeodomain-like
SMART	SM00717	6.2E-4	3	52	IPR001005	SANT/Myb domain
Pfam	PF00249	2.4E-12	4	39	IPR001005	SANT/Myb domain
Gene3D	G3DSA:1.10.10.60	1.5E-12	4	39	IPR009057	Homeodomain-like
CDD	cd00167	2.67E-9	7	39	No hit	No description

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0009737	Biological Process	response to abscisic acid
GO:2000652	Biological Process	regulation of secondary cell wall biogenesis
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding

Sequence ? help Back to Top
Protein Sequence Length: 62 aa Download sequence Send to blast
MCTRGHWRPS EDERLKELVA RYGPHNWNAI AEKLQGRSGT IDETCMHMHD HASTDHACVE 60 SI

Functional Description ? help Back to Top
Source	Description
UniProt	Transcription factor that confers sensitivity to abscisic acid (ABA) and salt, but tolerance to drought (PubMed:21399993). Regulates secondary cell wall (SCW) biosynthesis, especially in interfascicular and xylary fibers (PubMed:18952777, PubMed:23781226). {ECO:0000269\|PubMed:18952777, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:23781226}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00145	DAP	Transfer from AT1G17950	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_78895.2

Regulation -- Description ? help Back to Top
Source	Description
UniProt	INDUCTION: By abscisic acid (PubMed:16463103, PubMed:21399993). Accumulates in response to salt (PubMed:21399993). Triggered by MYB46 and MYB83 in the regulation of secondary cell wall biosynthesis (PubMed:19674407, PubMed:22197883). {ECO:0000269\|PubMed:16463103, ECO:0000269\|PubMed:19674407, ECO:0000269\|PubMed:21399993, ECO:0000269\|PubMed:22197883}.

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AC147426	3e-39	AC147426.2 Oryza sativa chromosome 3 B1377B10 genomic sequence, complete sequence.
GenBank	AF377946	3e-39	AF377946.3 Oryza sativa (japonica cultivar-group) chromosome 3, BAC clone OSJNBa0031O09, complete sequence.
GenBank	AP014959	3e-39	AP014959.1 Oryza sativa Japonica Group DNA, chromosome 3, cultivar: Nipponbare, complete sequence.
GenBank	CP012611	3e-39	CP012611.1 Oryza sativa Indica Group cultivar RP Bio-226 chromosome 3 sequence.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020166078.1	3e-21	transcription factor MYB52-like
Swissprot	Q6R0C4	2e-17	MYB52_ARATH; Transcription factor MYB52
TrEMBL	A0A287N4A0	2e-39	A0A287N4A0_HORVV; Uncharacterized protein
STRING	EMT05186	2e-21	(Aegilops tauschii)
STRING	Traes_4BS_AAFB56987.1	8e-21	(Triticum aestivum)
STRING	Traes_4DS_926486EE0.1	7e-21	(Triticum aestivum)

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G17950.1	7e-20	myb domain protein 52

Publications ? help Back to Top
Duarte JM, et al. Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis. Mol. Biol. Evol., 2006. 23(2): p. 469-78 [PMID:16280546] Cassan-Wang H, et al. Identification of novel transcription factors regulating secondary cell wall formation in Arabidopsis. Front Plant Sci, 2013. 4: p. 189 [PMID:23781226] Shi D, et al. MYB52 Negatively Regulates Pectin Demethylesterification in Seed Coat Mucilage. Plant Physiol., 2018. 176(4): p. 2737-2749 [PMID:29440562]