 |
Plant Transcription
Factor Database
|
Transcription Factor Information
Basic
Information? help
Back to Top |
TF ID |
MLOC_74758.3 |
Organism |
|
Taxonomic ID |
|
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
Family |
WOX |
Protein Properties |
Length: 96aa MW: 10987.4 Da PI: 10.693 |
Description |
WOX family protein |
Gene Model |
Gene Model ID |
Type |
Source |
Coding Sequence |
MLOC_74758.3 | genome | IBSC | View CDS |
|
Signature Domain? help Back to Top |
 |
No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
1 | Homeobox | 66.5 | 3.4e-21 | 11 | 72 | 1 | 57 |
TT--SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
Homeobox 1 rrkRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
++ R+++t+eq+++L elF+ r+ps+e++++++++l +++ ++V++WFqN++a+e++
MLOC_74758.3 11 KCGRWNPTAEQVKVLTELFRAgLRTPSTEQIQRISTHLsalgKVESKNVFYWFQNHKARERH 72
568*****************99**************************************95 PP
|
2 | Wus_type_Homeobox | 110 | 1.3e-35 | 12 | 73 | 3 | 64 |
Wus_type_Homeobox 3 rtRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqk 64
+ RW+Pt+eQ+k+L+el+++GlrtP++e+iqri+++L++ Gk+e+kNVfyWFQN+kaRer++
MLOC_74758.3 12 CGRWNPTAEQVKVLTELFRAGLRTPSTEQIQRISTHLSALGKVESKNVFYWFQNHKARERHH 73
78**********************************************************97 PP
|
Gene Ontology ? help Back to Top |
GO Term |
GO Category |
GO Description |
GO:0009733 | Biological Process | response to auxin |
GO:0010078 | Biological Process | maintenance of root meristem identity |
GO:1902459 | Biological Process | positive regulation of stem cell population maintenance |
GO:0016787 | Molecular Function | hydrolase activity |
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Functional Description ? help
Back to Top |
Source |
Description |
UniProt | Transcription factor which may be involved in the specification and maintenance of the stem cells (QC cells) in the root apical meristem (RAM). {ECO:0000269|PubMed:12904206}. |
Annotation --
Nucleotide ? help
Back to Top |
Source |
Hit ID |
E-value |
Description |
GenBank | AK370947 | 1e-160 | AK370947.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2120M06. |
Publications
? help Back to Top |
- Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] - Li S, et al.
OsFIE2 plays an essential role in the regulation of rice vegetative and reproductive development. New Phytol., 2014. 201(1): p. 66-79 [PMID:24020752] - Chu H, et al.
A CLE-WOX signalling module regulates root meristem maintenance and vascular tissue development in rice. J. Exp. Bot., 2013. 64(17): p. 5359-69 [PMID:24043854] - Wang W, et al.
Dwarf Tiller1, a Wuschel-related homeobox transcription factor, is required for tiller growth in rice. PLoS Genet., 2014. 10(3): p. e1004154 [PMID:24625559] - Coudert Y, et al.
Identification of CROWN ROOTLESS1-regulated genes in rice reveals specific and conserved elements of postembryonic root formation. New Phytol., 2015. 206(1): p. 243-54 [PMID:25442012]
|