![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_66345.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 179aa MW: 19717.1 Da PI: 9.1158 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 102.6 | 2.3e-32 | 101 | 159 | 1 | 59 |
---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 ldDgy+WrKYGqK+vk+s +prsYYrCt+++C+vkk+ver +ed ++v++tYeg+H+h+ MLOC_66345.1 101 LDDGYKWRKYGQKVVKNSLHPRSYYRCTHSNCRVKKRVERLSEDCRMVITTYEGRHTHT 159 59********************************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
Gene3D | G3DSA:2.20.25.80 | 6.7E-34 | 86 | 159 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.68E-29 | 93 | 159 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 28.908 | 96 | 158 | IPR003657 | WRKY domain |
SMART | SM00774 | 1.4E-37 | 101 | 160 | IPR003657 | WRKY domain |
Pfam | PF03106 | 2.5E-25 | 102 | 158 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 179 aa Download sequence Send to blast |
MFSSDHGGGL YPLLPGIPFC HSAASLEKPT GFAPLGGTGE AGTSAARAGN EIAATTTTTT 60 TASCHGPSSW WKGAEKGKMK VRRKMREPRF CFQTRSEVDV LDDGYKWRKY GQKVVKNSLH 120 PRSYYRCTHS NCRVKKRVER LSEDCRMVIT TYEGRHTHTP CSDDDAGGDH TGSCTFTSF |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-25 | 92 | 158 | 8 | 74 | Probable WRKY transcription factor 4 |
2lex_A | 1e-25 | 92 | 158 | 8 | 74 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_66345.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | EU665432 | 0.0 | EU665432.1 Triticum aestivum WRKY3 transcription factor mRNA, complete cds. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020155480.1 | 1e-118 | probable WRKY transcription factor 12 | ||||
Swissprot | Q93WY4 | 1e-59 | WRK12_ARATH; Probable WRKY transcription factor 12 | ||||
TrEMBL | A0A287IZ53 | 1e-131 | A0A287IZ53_HORVV; Uncharacterized protein | ||||
STRING | MLOC_66345.1 | 1e-132 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP1138 | 38 | 130 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G44745.1 | 2e-60 | WRKY family protein |
Publications ? help Back to Top | |||
---|---|---|---|
|