![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_59246.1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | WRKY | ||||||||
Protein Properties | Length: 87aa MW: 9132.93 Da PI: 8.503 | ||||||||
Description | WRKY family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | WRKY | 56.8 | 4.6e-18 | 1 | 38 | 22 | 59 |
EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS WRKY 22 rsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 rsYY+Ct ++C+v+k++er+++dp++v +tY+g+Hnh+ MLOC_59246.1 1 RSYYKCTAENCNVRKQIERASTDPRCVLTTYTGRHNHD 38 9************************************7 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
SMART | SM00774 | 6.7E-8 | 1 | 39 | IPR003657 | WRKY domain |
SuperFamily | SSF118290 | 9.15E-14 | 1 | 40 | IPR003657 | WRKY domain |
Pfam | PF03106 | 1.2E-11 | 1 | 38 | IPR003657 | WRKY domain |
PROSITE profile | PS50811 | 20.507 | 1 | 40 | IPR003657 | WRKY domain |
Gene3D | G3DSA:2.20.25.80 | 7.9E-16 | 1 | 40 | IPR003657 | WRKY domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0006355 | Biological Process | regulation of transcription, DNA-templated | ||||
GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding | ||||
GO:0043565 | Molecular Function | sequence-specific DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 87 aa Download sequence Send to blast |
RSYYKCTAEN CNVRKQIERA STDPRCVLTT YTGRHNHDPP GRGAGAAAAA GAGGGSSSDP 60 VPSTVNPSAS TLHQPSGIHQ LKEENRD |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
1wj2_A | 1e-14 | 1 | 40 | 38 | 77 | Probable WRKY transcription factor 4 |
2lex_A | 1e-14 | 1 | 40 | 38 | 77 | Probable WRKY transcription factor 4 |
Search in ModeBase |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_59246.1 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | AK363803 | 1e-143 | AK363803.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, partial cds, clone: NIASHv2019A07. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_020197516.1 | 2e-39 | probable WRKY transcription factor 58 | ||||
TrEMBL | A0A287SEN1 | 3e-55 | A0A287SEN1_HORVV; Uncharacterized protein | ||||
TrEMBL | M0XDY2 | 3e-57 | M0XDY2_HORVV; Uncharacterized protein | ||||
STRING | MLOC_59246.1 | 5e-58 | (Hordeum vulgare) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Monocots | OGMP2875 | 32 | 36 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G03340.1 | 8e-16 | WRKY DNA-binding protein 3 |