PlantTFDB - Plant Transcription Factor Database @ CBI, PKU

cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum

Family

MIKC_MADS

Protein Properties

Length: 157aa MW: 18309.9 Da PI: 9.9752

Description

MIKC_MADS family protein

Gene Model

Gene Model ID	Type	Source	Coding Sequence
MLOC_56472.2	genome	IBSC	View CDS

Signature Domain? help Back to Top

No.	Domain	Score	E-value	Start	End	HMM Start	HMM End
1	SRF-TF	100.7	5.7e-32	9	59	1	51
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE- CS SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeyss 51 krienk+nrqvtf+kRrng+lKKA+ELSvLCdaeva+i+fs++gklye++s MLOC_56472.2 9 KRIENKINRQVTFAKRRNGLLKKAYELSVLCDAEVALIVFSNRGKLYEFCS 59 79***********************************************96 PP
2	K-box	81.6	1.8e-27	83	157	7	81
K-box 7 ksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqieelq 81 ++ e+++ +++++e+ kLk +++nLqr+qR+llGedL+sL +keL++Le+qL++slk+iR+++++++++q+ elq MLOC_56472.2 83 QNRENEQLKNSRNEYLKLKTRVDNLQRTQRNLLGEDLDSLGIKELESLEKQLDSSLKHIRTTRTQHMVDQLTELQ 157 45788999****************************************************************997 PP

Protein Features ? help Back to Top

Database	Entry ID	E-value	Start	End	InterPro ID	Description
PROSITE profile	PS50066	33.347	1	61	IPR002100	Transcription factor, MADS-box
SMART	SM00432	1.1E-41	1	60	IPR002100	Transcription factor, MADS-box
CDD	cd00265	6.38E-43	2	77	No hit	No description
SuperFamily	SSF55455	1.15E-34	2	90	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.3E-33	3	23	IPR002100	Transcription factor, MADS-box
PROSITE pattern	PS00350	0	3	57	IPR002100	Transcription factor, MADS-box
Pfam	PF00319	7.0E-27	10	57	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.3E-33	23	38	IPR002100	Transcription factor, MADS-box
PRINTS	PR00404	3.3E-33	38	59	IPR002100	Transcription factor, MADS-box
Pfam	PF01486	1.4E-20	86	157	IPR002487	Transcription factor, K-box
PROSITE profile	PS51297	12.803	90	157	IPR002487	Transcription factor, K-box

Gene Ontology ? help Back to Top
GO Term	GO Category	GO Description
GO:0001708	Biological Process	cell fate specification
GO:0006355	Biological Process	regulation of transcription, DNA-templated
GO:0010093	Biological Process	specification of floral organ identity
GO:0048481	Biological Process	plant ovule development
GO:0048833	Biological Process	specification of floral organ number
GO:0005634	Cellular Component	nucleus
GO:0003677	Molecular Function	DNA binding
GO:0003700	Molecular Function	transcription factor activity, sequence-specific DNA binding
GO:0046983	Molecular Function	protein dimerization activity

Sequence ? help Back to Top
Protein Sequence Length: 157 aa Download sequence Send to blast
MGRGRVELKR IENKINRQVT FAKRRNGLLK KAYELSVLCD AEVALIVFSN RGKLYEFCST 60 QSMTKTLDKY QKCSYAGPET TVQNRENEQL KNSRNEYLKL KTRVDNLQRT QRNLLGEDLD 120 SLGIKELESL EKQLDSSLKH IRTTRTQHMV DQLTELQ

3D Structure ? help Back to Top

PDB ID	Evalue	Query Start	Query End	Hit Start	Hit End	Description
4ox0_A	5e-27	75	157	1	84	Developmental protein SEPALLATA 3
4ox0_B	5e-27	75	157	1	84	Developmental protein SEPALLATA 3
4ox0_C	5e-27	75	157	1	84	Developmental protein SEPALLATA 3
4ox0_D	5e-27	75	157	1	84	Developmental protein SEPALLATA 3
Search in ModeBase

Functional Description ? help Back to Top
Source	Description
UniProt	Probable transcription factor.
UniProt	Probable transcription factor. May be involved in the control of flowering time. {ECO:0000269\|PubMed:9339904, ECO:0000269\|Ref.10}.

Binding Motif ? help Back to Top
Motif ID	Method	Source	Motif file
MP00605	ChIP-seq	Transfer from AT1G24260	Download

Cis-element ? help Back to Top
Source	Link
PlantRegMap	MLOC_56472.2

Regulation -- PlantRegMap ? help Back to Top
Source	Upstream Regulator	Target Gene
PlantRegMap	Retrieve	Retrieve

Annotation -- Nucleotide ? help Back to Top
Source	Hit ID	E-value	Description
GenBank	AJ249147	0.0	AJ249147.1 Hordeum vulgare mRNA for MADS-box protein 9 (m9 gene).
GenBank	AK249904	0.0	AK249904.1 Hordeum vulgare subsp. vulgare cDNA clone: FLbaf59h02, mRNA sequence.
GenBank	AY541068	0.0	AY541068.1 Hordeum vulgare subsp. vulgare AGAMOUS LIKE9-like protein mRNA, complete cds.

Annotation -- Protein ? help Back to Top
Source	Hit ID	E-value	Description
Refseq	XP_020194872.1	1e-109	MADS-box transcription factor 7
Swissprot	P0C5B0	1e-105	MADS7_ORYSI; MADS-box transcription factor 7
Swissprot	Q0J466	1e-105	MADS7_ORYSJ; MADS-box transcription factor 7
TrEMBL	A0A287WJY0	1e-109	A0A287WJY0_HORVV; Uncharacterized protein
STRING	MLOC_56472.2	1e-111	(Hordeum vulgare)

Orthologous Group ? help Back to Top
Lineage	Orthologous Group ID	Taxa Number	Gene Number
Monocots	OGMP3483	34	69

Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID	E-value	Description
AT1G24260.1	4e-83	MIKC_MADS family protein

Publications ? help Back to Top
Schmitz J, et al. Cloning, mapping and expression analysis of barley MADS-box genes. Plant Mol. Biol., 2000. 42(6): p. 899-913 [PMID:10890536] Kikuchi S, et al. Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice. Science, 2003. 301(5631): p. 376-9 [PMID:12869764] Shitsukawa N, et al. Genetic and epigenetic alteration among three homoeologous genes of a class E MADS box gene in hexaploid wheat. Plant Cell, 2007. 19(6): p. 1723-37 [PMID:17586655] Bai X,Wang Q,Chu C Excision of a selective marker in transgenic rice using a novel Cre/loxP system controlled by a floral specific promoter. Transgenic Res., 2008. 17(6): p. 1035-43 [PMID:18437520] Qu L, et al. Expression pattern and functional analysis of a MADS-box gene M79 from rice. Sci. China, C, Life Sci., 2001. 44(2): p. 161-9 [PMID:18726433] Cui R, et al. Functional conservation and diversification of class E floral homeotic genes in rice (Oryza sativa). Plant J., 2010. 61(5): p. 767-81 [PMID:20003164] Li H, et al. The AGL6-like gene OsMADS6 regulates floral organ and meristem identities in rice. Cell Res., 2010. 20(3): p. 299-313 [PMID:20038961] Seok HY, et al. Rice ternary MADS protein complexes containing class B MADS heterodimer. Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604 [PMID:20888318] Tang X, et al. Global gene profiling of laser-captured pollen mother cells indicates molecular pathways and gene subfamilies involved in rice meiosis. Plant Physiol., 2010. 154(4): p. 1855-70 [PMID:20959420] Wang SS,Wang CS,Tseng TH,Hou YL,Chen KY High-resolution genetic mapping and candidate gene identification of the SLP1 locus that controls glume development in rice. Theor. Appl. Genet., 2011. 122(8): p. 1489-96 [PMID:21327937] Li H, et al. Rice MADS6 interacts with the floral homeotic genes SUPERWOMAN1, MADS3, MADS58, MADS13, and DROOPING LEAF in specifying floral organ identities and meristem fate. Plant Cell, 2011. 23(7): p. 2536-52 [PMID:21784949] Yoshida H Is the lodicule a petal: molecular evidence? Plant Sci., 2012. 184: p. 121-8 [PMID:22284716] Duan Y, et al. Characterization of Osmads6-5, a null allele, reveals that OsMADS6 is a critical regulator for early flower development in rice (Oryza sativa L.). Plant Mol. Biol., 2012. 80(4-5): p. 429-42 [PMID:22933119] Wong CE,Singh MB,Bhalla PL Novel members of the AGAMOUS LIKE 6 subfamily of MIKCC-type MADS-box genes in soybean. BMC Plant Biol., 2013. 13: p. 105 [PMID:23870482] Hu Z,Ding X,Hu S,Sun Y,Xia L Tissue-specifically regulated site-specific excision of selectable marker genes in bivalent insecticidal, genetically-modified rice. Biotechnol. Lett., 2013. 35(12): p. 2177-83 [PMID:23974493] Bai X, et al. Regulatory role of FZP in the determination of panicle branching and spikelet formation in rice. Sci Rep, 2016. 6: p. 19022 [PMID:26744119] Dreni L,Zhang D Flower development: the evolutionary history and functions of the AGL6 subfamily MADS-box genes. J. Exp. Bot., 2016. 67(6): p. 1625-38 [PMID:26956504]