 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
MLOC_44514.2 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
| Family |
MIKC_MADS |
| Protein Properties |
Length: 169aa MW: 19541.6 Da PI: 10.4471 |
| Description |
MIKC_MADS family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| MLOC_44514.2 | genome | IBSC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | SRF-TF | 82.5 | 2.7e-26 | 9 | 58 | 1 | 50 |
S---SHHHHHHHHHHHHHHHHHHHHHHHHHHT-EEEEEEE-TTSEEEEEE CS
SRF-TF 1 krienksnrqvtfskRrngilKKAeELSvLCdaevaviifsstgklyeys 50
krien+snrqvtf+kRr+g+ KKA E+ vLCdaev v+ifss gkly++
MLOC_44514.2 9 KRIENSSNRQVTFAKRRAGLVKKAREIGVLCDAEVGVVIFSSAGKLYDFW 58
79*********************************************995 PP
|
| 2 | K-box | 64.8 | 3e-22 | 71 | 148 | 1 | 78 |
K-box 1 yqkssgksleeakaeslqqelakLkkeienLqreqRhllGedLesLslkeLqqLeqqLekslkkiRskKnellleqie 78
yq++sgk l+++k++s + e++++kke++n+q e+Rh++Ged++sL+ keL +e++L ++ ++ R+k +++++++ +
MLOC_44514.2 71 YQTNSGKILWDEKHKSISAEIDRVKKENDNMQIELRHMKGEDVNSLQPKELIAIEEALTNGQTSLRDKMMDHWKMHRR 148
89999999************************************************************9999988766 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0010093 | Biological Process | specification of floral organ identity |
| GO:0005634 | Cellular Component | nucleus |
| GO:0005737 | Cellular Component | cytoplasm |
| GO:0003677 | Molecular Function | DNA binding |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0046983 | Molecular Function | protein dimerization activity |
| Sequence ? help Back to Top |
| Protein Sequence Length: 169 aa
Download sequence Send
to blast |
MGRGKIEIKR IENSSNRQVT FAKRRAGLVK KAREIGVLCD AEVGVVIFSS AGKLYDFWTP 60
KTTLPRILEK YQTNSGKILW DEKHKSISAE IDRVKKENDN MQIELRHMKG EDVNSLQPKE 120
LIAIEEALTN GQTSLRDKMM DHWKMHRRNV WALKLSLRFE FPSVHHGVS
|
| 3D Structure ? help Back to Top |
 |
| PDB ID |
Evalue |
Query Start |
Query End |
Hit Start |
Hit End |
Description |
| 1tqe_P | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_Q | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_R | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 1tqe_S | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_A | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_B | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_C | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_D | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_E | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| 6c9l_F | 3e-19 | 1 | 86 | 1 | 78 | Myocyte-specific enhancer factor 2B |
| Search in ModeBase |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Probable transcription factor involved in the development of floral organs. B-class protein required for normal development of lodicules and stamens (whorls 2 and 3). May function as a heterodimer with MADS16. {ECO:0000269|PubMed:9869408}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | AK371286 | 0.0 | AK371286.1 Hordeum vulgare subsp. vulgare mRNA for predicted protein, complete cds, clone: NIASHv2129M01. |
| GenBank | AY541066 | 0.0 | AY541066.1 Hordeum vulgare subsp. vulgare PISTILLATA-like protein mRNA, complete cds. |
| GenBank | KU740308 | 0.0 | KU740308.1 Hordeum vulgare PISTILLATA-like MADS-box transcription factor PI-1 mRNA, complete cds. |
| Publications
? help Back to Top |
- Ronai Z, et al.
Transcription factor binding study by capillary zone electrophoretic mobility shift assay.
Electrophoresis, 2003. 24(1-2): p. 96-100
[PMID:12652578] - Kikuchi S, et al.
Collection, mapping, and annotation of over 28,000 cDNA clones from japonica rice.
Science, 2003. 301(5631): p. 376-9
[PMID:12869764] - Kang HG,An G
Morphological alterations by ectopic expression of the rice OsMADS4 gene in tobacco plants.
Plant Cell Rep., 2005. 24(2): p. 120-6
[PMID:15703945] - Cheng CH, et al.
A fine physical map of the rice chromosome 5.
Mol. Genet. Genomics, 2005. 274(4): p. 337-45
[PMID:16261349] - Chen C, et al.
Adapting rice anther culture to gene transformation and RNA interference.
Sci. China, C, Life Sci., 2006. 49(5): p. 414-28
[PMID:17172048] - Yoshida H, et al.
superwoman1-cleistogamy, a hopeful allele for gene containment in GM rice.
Plant Biotechnol. J., 2007. 5(6): p. 835-46
[PMID:17764519] - Yao SG,Ohmori S,Kimizu M,Yoshida H
Unequal genetic redundancy of rice PISTILLATA orthologs, OsMADS2 and OsMADS4, in lodicule and stamen development.
Plant Cell Physiol., 2008. 49(5): p. 853-7
[PMID:18378529] - Seok HY, et al.
Rice ternary MADS protein complexes containing class B MADS heterodimer.
Biochem. Biophys. Res. Commun., 2010. 401(4): p. 598-604
[PMID:20888318] - Wang H, et al.
OsMADS32 interacts with PI-like proteins and regulates rice flower development.
J Integr Plant Biol, 2015. 57(5): p. 504-13
[PMID:25081486]
|
