 |
Plant Transcription
Factor Database
|
Transcription Factor Information
|
Basic
Information? help
Back to Top |
| TF ID |
MLOC_16746.1 |
| Common Name | WRKY48 |
| Organism |
|
| Taxonomic ID |
|
| Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
| Family |
WRKY |
| Protein Properties |
Length: 96aa MW: 10857.2 Da PI: 9.5346 |
| Description |
WRKY family protein |
| Gene Model |
| Gene Model ID |
Type |
Source |
Coding Sequence |
| MLOC_16746.1 | genome | IBSC | View CDS |
|
| Signature Domain? help Back to Top |
 |
| No. |
Domain |
Score |
E-value |
Start |
End |
HMM Start |
HMM End |
| 1 | WRKY | 66 | 6.1e-21 | 42 | 96 | 2 | 57 |
--SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--S CS
WRKY 2 dDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHn 57
+Dgy+W+KYGqK +k+ + rsY+rC ++C +kkkve + dp+ + ++Y g H+
MLOC_16746.1 42 EDGYQWKKYGQKFIKNIQKIRSYFRCRDRRCGAKKKVEWQPGDPS-LRVVYDGAHQ 96
7****************************************9987.5899****96 PP
|
| Gene Ontology ? help Back to Top |
| GO Term |
GO Category |
GO Description |
| GO:0006355 | Biological Process | regulation of transcription, DNA-templated |
| GO:0003700 | Molecular Function | transcription factor activity, sequence-specific DNA binding |
| GO:0043565 | Molecular Function | sequence-specific DNA binding |
| Functional Description ? help
Back to Top |
| Source |
Description |
| UniProt | Transcription factor. Interacts specifically with the W box (5'-(T)TGAC[CT]-3'), a frequently occurring elicitor-responsive cis-acting element (By similarity). {ECO:0000250}. |
| Annotation --
Nucleotide ? help
Back to Top |
| Source |
Hit ID |
E-value |
Description |
| GenBank | JQ806389 | 1e-160 | JQ806389.1 Hordeum vulgare WRKY transcript factor 48 (WRKY48) mRNA, complete cds. |
| Publications
? help Back to Top |
- Meng Y,Wise RP
HvWRKY10, HvWRKY19, and HvWRKY28 regulate Mla-triggered immunity and basal defense to barley powdery mildew.
Mol. Plant Microbe Interact., 2012. 25(11): p. 1492-505
[PMID:22809275] - Ding Y, et al.
Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
BMC Plant Biol., 2013. 13: p. 229
[PMID:24377444] - Jiang Y,Qiu Y,Hu Y,Yu D
Heterologous Expression of AtWRKY57 Confers Drought Tolerance in Oryza sativa.
Front Plant Sci, 2016. 7: p. 145
[PMID:26904091] - Jiang Y,Yu D
The WRKY57 Transcription Factor Affects the Expression of Jasmonate ZIM-Domain Genes Transcriptionally to Compromise Botrytis cinerea Resistance.
Plant Physiol., 2016. 171(4): p. 2771-82
[PMID:27268959] - Huang KC,Lin WC,Cheng WH
Salt hypersensitive mutant 9, a nucleolar APUM23 protein, is essential for salt sensitivity in association with the ABA signaling pathway in Arabidopsis.
BMC Plant Biol., 2018. 18(1): p. 40
[PMID:29490615]
|
