![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MLOC_12609.2 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; Liliopsida; Petrosaviidae; commelinids; Poales; Poaceae; BOP clade; Pooideae; Triticodae; Triticeae; Hordeinae; Hordeum
|
||||||||
Family | Nin-like | ||||||||
Protein Properties | Length: 57aa MW: 6618.1 Da PI: 11.0492 | ||||||||
Description | Nin-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | RWP-RK | 69.8 | 3.7e-22 | 1 | 37 | 16 | 52 |
RWP-RK 16 lpikdAAkeLgvclTvLKriCRqyGIkRWPhRkiksl 52 +pik AA eL+v+lT+LK++CR+ GI+RWPhRk+ksl MLOC_12609.2 1 MPIKRAAEELNVGLTILKKRCREIGIPRWPHRKVKSL 37 79*********************************97 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51519 | 14.311 | 1 | 57 | IPR003035 | RWP-RK domain |
Pfam | PF02042 | 4.3E-18 | 1 | 37 | IPR003035 | RWP-RK domain |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 57 aa Download sequence Send to blast |
MPIKRAAEEL NVGLTILKKR CREIGIPRWP HRKVKSLETL IKNAQVFLLI CVSFLFV |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. {ECO:0000250}. |
Cis-element ? help Back to Top | |
---|---|
Source | Link |
PlantRegMap | MLOC_12609.2 |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_025822796.1 | 2e-21 | protein RKD1 | ||||
Swissprot | Q9LVU8 | 3e-18 | RKD4_ARATH; Protein RKD4 | ||||
TrEMBL | A0A287UQZ0 | 3e-33 | A0A287UQZ0_HORVV; Uncharacterized protein | ||||
STRING | MLOC_12609.1 | 1e-23 | (Hordeum vulgare) |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT5G53040.1 | 1e-20 | RWP-RK domain-containing protein |
Publications ? help Back to Top | |||
---|---|---|---|
|