![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C025504P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | LBD | ||||||||
Protein Properties | Length: 103aa MW: 11653.8 Da PI: 9.6206 | ||||||||
Description | LBD family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | DUF260 | 74.5 | 2e-23 | 16 | 82 | 1 | 67 |
DUF260 1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAea 67 +CaaCk+lrrkC+++C+lapyfp ++p kfa+vh+++Ga nv+k+ ++lpe e++++++ y ++ MELO3C025504P1 16 PCAACKILRRKCVDNCILAPYFPPTDPLKFAAVHRIYGAGNVIKFFQELPERVGERMLRAVWYTKRM 82 7************************************************************998665 PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS50891 | 15.822 | 15 | 102 | IPR004883 | Lateral organ boundaries, LOB |
Pfam | PF03195 | 6.7E-22 | 16 | 83 | IPR004883 | Lateral organ boundaries, LOB |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 103 aa Download sequence Send to blast |
NTMQSPPPPC TVVLSPCAAC KILRRKCVDN CILAPYFPPT DPLKFAAVHR IYGAGNVIKF 60 FQELPERVGE RMLRAVWYTK RMQESETQSM GALVQYFNFK IK* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
5ly0_A | 9e-20 | 15 | 93 | 10 | 90 | LOB family transfactor Ramosa2.1 |
5ly0_B | 9e-20 | 15 | 93 | 10 | 90 | LOB family transfactor Ramosa2.1 |
Search in ModeBase |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681891 | 1e-100 | LN681891.1 Cucumis melo genomic scaffold, anchoredscaffold00079. | |||
GenBank | LN713263 | 1e-100 | LN713263.1 Cucumis melo genomic chromosome, chr_9. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_022939142.1 | 4e-30 | LOB domain-containing protein 1-like | ||||
Swissprot | Q9SK08 | 3e-27 | LBD11_ARATH; LOB domain-containing protein 11 | ||||
TrEMBL | A0A0A0KU20 | 1e-34 | A0A0A0KU20_CUCSA; Uncharacterized protein | ||||
STRING | XP_004173617.1 | 7e-36 | (Cucumis sativus) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF1303 | 34 | 106 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G28500.1 | 1e-29 | LOB domain-containing protein 11 |