![]() |
PlantRegMap/PlantTFDB v5.0
Plant Transcription
Factor Database
|
Home TFext BLAST Prediction Download Help About Links PlantRegMap |
Transcription Factor Information
Basic Information? help Back to Top | |||||||||
---|---|---|---|---|---|---|---|---|---|
TF ID | MELO3C022963P1 | ||||||||
Organism | |||||||||
Taxonomic ID | |||||||||
Taxonomic Lineage |
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Cucurbitales; Cucurbitaceae; Benincaseae; Cucumis
|
||||||||
Family | G2-like | ||||||||
Protein Properties | Length: 75aa MW: 8590.14 Da PI: 11.1669 | ||||||||
Description | G2-like family protein | ||||||||
Gene Model |
|
Signature Domain? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
No. | Domain | Score | E-value | Start | End | HMM Start | HMM End |
1 | G2-like | 87.1 | 1.7e-27 | 20 | 69 | 2 | 51 |
G2-like 2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 prlrWtpeLH+ Fv+ ve LGG ++AtPk+il++m+vkgL ++h+kSHLQ MELO3C022963P1 20 PRLRWTPELHRYFVQTVEILGGRNQATPKKILQMMGVKGLKISHIKSHLQ 69 8************************************************* PP |
Protein Features ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Database | Entry ID | E-value | Start | End | InterPro ID | Description |
PROSITE profile | PS51294 | 12.507 | 16 | 74 | IPR017930 | Myb domain |
Gene3D | G3DSA:1.10.10.60 | 1.1E-24 | 17 | 69 | IPR009057 | Homeodomain-like |
SuperFamily | SSF46689 | 1.79E-14 | 20 | 72 | IPR009057 | Homeodomain-like |
TIGRFAMs | TIGR01557 | 7.6E-22 | 20 | 72 | IPR006447 | Myb domain, plants |
Pfam | PF00249 | 3.7E-8 | 21 | 71 | IPR001005 | SANT/Myb domain |
Gene Ontology ? help Back to Top | ||||||
---|---|---|---|---|---|---|
GO Term | GO Category | GO Description | ||||
GO:0003677 | Molecular Function | DNA binding |
Sequence ? help Back to Top |
---|
Protein Sequence Length: 75 aa Download sequence Send to blast |
MKSCSSDRIG VRQYNKSELP RLRWTPELHR YFVQTVEILG GRNQATPKKI LQMMGVKGLK 60 ISHIKSHLQV LFPN* |
3D Structure ? help Back to Top | ||||||
---|---|---|---|---|---|---|
PDB ID | Evalue | Query Start | Query End | Hit Start | Hit End | Description |
6j4r_A | 1e-16 | 21 | 69 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_B | 1e-16 | 21 | 69 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_C | 1e-16 | 21 | 69 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
6j4r_D | 1e-16 | 21 | 69 | 3 | 51 | Protein PHOSPHATE STARVATION RESPONSE 1 |
Search in ModeBase |
Functional Description ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Description | |||||
UniProt | Putative transcription factor. |
Regulation -- PlantRegMap ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Upstream Regulator | Target Gene | ||||
PlantRegMap | Retrieve | - |
Annotation -- Nucleotide ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | |||
GenBank | LN681865 | 5e-66 | LN681865.1 Cucumis melo genomic scaffold, anchoredscaffold01599. | |||
GenBank | LN713261 | 5e-66 | LN713261.1 Cucumis melo genomic chromosome, chr_7. |
Annotation -- Protein ? help Back to Top | |||||||
---|---|---|---|---|---|---|---|
Source | Hit ID | E-value | Description | ||||
Refseq | XP_008466796.1 | 1e-44 | PREDICTED: putative Myb family transcription factor At1g14600 | ||||
Swissprot | Q700D9 | 2e-22 | MYBF_ARATH; Putative Myb family transcription factor At1g14600 | ||||
TrEMBL | A0A1S3CS11 | 2e-43 | A0A1S3CS11_CUCME; putative Myb family transcription factor At1g14600 | ||||
STRING | XP_008466796.1 | 4e-44 | (Cucumis melo) |
Orthologous Group ? help Back to Top | |||
---|---|---|---|
Lineage | Orthologous Group ID | Taxa Number | Gene Number |
Fabids | OGEF9186 | 28 | 39 |
Best hit in Arabidopsis thaliana ? help Back to Top | ||||||
---|---|---|---|---|---|---|
Hit ID | E-value | Description | ||||
AT2G02060.1 | 3e-26 | G2-like family protein |